The domain within your query sequence starts at position 838 and ends at position 903; the E-value for the DDT domain shown below is 3.75e-18.
SRAFSDCLTIVEFLHSFGKVLGFDLTKDVPSLGVLQEGLLCQGDSLDKVQDLLVRLLKAA LHDPGL
DDTdomain in different transcription and chromosome remodeling factors |
---|
SMART accession number: | SM00571 |
---|---|
Description: | - |
Interpro abstract (IPR018501): | The DDT has been named after the better characterised DNA-binding homeobox- containing proteins and the Different Transcription and chromatin remodelling factors in which it is found. It is a domain of about 60 amino acids which is exclusively associated with nuclear domains like AT-Hook, PHD finger, methyl-CpG-binding domain, bromodomain and DNA-binding homeodomain. The DDT domain is characterised by a number of conserved aromatic and charged residues and is predicted to consist of three alpha helices. A DNA-binding function for the DDT domain has been proposed [ (PUBMED:11246006) ]. |
Family alignment: |
There are 3151 DDT domains in 3146 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)