The domain within your query sequence starts at position 127 and ends at position 232; the E-value for the DIRP domain shown below is 2.2e-71.

FYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERS
ALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGTKVTARLRG

DIRP

DIRP
SMART accession number:SM01135
Description: DIRP (Domain in Rb-related Pathway) is postulated to be involved in the Rb-related pathway, which is encoded by multiple eukaryotic genomes and is present in proteins including lin-9 of Caenorhabditis elegans, aly of fruit fly and mustard weed. Studies of lin-9 and aly of fruit fly proteins containing DIRP suggest that this domain might be involved in development. Aly, lin-9, act in parallel to, or downstream of, activation of MAPK by the RTK-Ras signalling pathway.
Interpro abstract (IPR033471):

DIRP (Domain in Rb-related Pathway) is postulated to be involved in the Rb-related pathway, which is encoded by multiple eukaryotic genomes and is present in proteins including lin-9 of Caenorhabditis elegans, aly of fruit fly and mustard weed. Studies of lin-9 and aly of fruit fly proteins containing DIRP suggest that this domain might be involved in development. Aly, lin-9, act in parallel to, or downstream of, activation of MAPK by the RTK-Ras signalling pathway [ (PUBMED:11076766) ].

Family alignment:
View or

There are 1221 DIRP domains in 1219 proteins in SMART's nrdb database.

Click on the following links for more information.