The domain within your query sequence starts at position 137 and ends at position 194; the E-value for the DM14 domain shown below is 1.02e-14.

ATLQERLTLYQSALESARQAGDSAKMRRYDRGLKTLENLLVSAKKGNIINEADIPPPV

DM14

Repeats in fly CG4713, worm Y37H9A.3 and human FLJ20241.
DM14
SMART accession number:SM00685
Description: -
Interpro abstract (IPR006608):

This domain is found, sometimes in multiple copies, in proteins whose functions have not been characterised.

Family alignment:
View or

There are 3682 DM14 domains in 975 proteins in SMART's nrdb database.

Click on the following links for more information.