The domain within your query sequence starts at position 139 and ends at position 283; the E-value for the DP domain shown below is 8e-92.

QECQNLEIEKQRRIERIKQKRAQLQELLLQQIAFKNLVQRNRQNEQQNQGPPAVNSTIQL
PFIIINTSRKTVIDCSISSDKFEYLFNFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDL
KIAKSLVPKALEGYITDISTGPSWL

DP

Transcription factor DP
DP
SMART accession number:SM01138
Description: DP forms a heterodimer with E2F and regulates genes involved in cell cycle progression. The transcriptional activity of E2F is inhibited by the retinoblastoma protein which binds to the E2F-DP heterodimer [(PUBMED:16360038)] and negatively regulates the G1-S transition.
Interpro abstract (IPR014889):

The transcription factor DP (dimerization partner) forms a heterodimer with E2F and regulates genes involved in cell cycle progression. The transcriptional activity of E2F is inhibited by the retinoblastoma protein which binds to the E2F-DP heterodimer [ (PUBMED:16360038) ] and negatively regulates the G1-S transition.

Though originally the role of DP in transcriptional activation was thought to be facilitating the binding of E2F to target DNA, it was latter shown that the C-terminal acidic region of DP1 binds strongly to the PH domain of p62 of TFIIH. and acts as a transactivation domain [ (PUBMED:27825926) ].

Family alignment:
View or

There are 1503 DP domains in 1502 proteins in SMART's nrdb database.

Click on the following links for more information.