The domain within your query sequence starts at position 178 and ends at position 240; the E-value for the DSL domain shown below is 1.48e-36.

WKSLHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMG
KEC

DSL

delta serrate ligand
DSL
SMART accession number:SM00051
Description: -
Interpro abstract (IPR001774):

Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates. In Caenorhabditis elegans, two DSL genes, lag-2 and apx-1, influence different cell fate decisions during development [ (PUBMED:8575327) ]. Molecular interaction between Notch and Serrate, another EGF-homologous transmembrane protein containing a region of striking similarity to Delta, has been shown and the same two EGF repeats of Notch may also constitute a Serrate binding domain [ (PUBMED:1657403) (PUBMED:7716513) ].

GO process:cell communication (GO:0007154)
GO component:membrane (GO:0016020)
Family alignment:
View or

There are 2659 DSL domains in 2480 proteins in SMART's nrdb database.

Click on the following links for more information.