The domain within your query sequence starts at position 176 and ends at position 241; the E-value for the DSRM domain shown below is 1.84e-18.

EISLVFEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATT
VLQELK

DSRM

Double-stranded RNA binding motif
DSRM
SMART accession number:SM00358
Description: -
Interpro abstract (IPR014720):

In contrast to other RNA-binding domains, the about 65 amino acids long dsRBD domain [ (PUBMED:1438302) (PUBMED:8036511) (PUBMED:7972084) ] has been found in a number of proteins that specifically recognise double-stranded RNAs. The dsRBD domain is also known as DSRM (Double-Stranded RNA-binding Motif). dsRBD proteins are mainly involved in posttranscriptional gene regulation, for example by preventing the expression of proteins or by mediating RNAs localization. This domain is also found in RNA editing proteins. Interaction of the dsRBD with RNA is unlikely to involve the recognition of specific sequences [ (PUBMED:1357546) (PUBMED:7527340) (PUBMED:8127710) ]. Nevertheless, multiple dsRBDs may be able to act in combination to recognise the secondary structure of specific RNAs (i.e. Staufen) [ (PUBMED:1438302) ]. NMR analysis of the third dsRBD of Drosophila Staufen have revealed an alpha-beta-beta-beta-alpha structure [ (PUBMED:7628456) ].

Family alignment:
View or

There are 49577 DSRM domains in 36103 proteins in SMART's nrdb database.

Click on the following links for more information.