The domain within your query sequence starts at position 5 and ends at position 62; the E-value for the DSS1_SEM1 domain shown below is 1.43e-26.

KQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEK

DSS1_SEM1

DSS1_SEM1
SMART accession number:SM01385
Description: This family contains the breast cancer tumour suppressor BRCA2-interacting protein DSS1 and its homologue SEM1, both of which are short acidic proteins. DSS1 has been shown to be a conserved component of the Rae1 mediated mRNA export pathway in Schizosaccharomyces pombe (PMID:15990877).
Interpro abstract (IPR007834):

This family includes yeast Sem1 and its mammalian homologue, DSS1.

Sem1/DSS1 (also known as rpn15) is a component of lid subcomplex of 26S proteasome regulatory subunit [ (PUBMED:23643786) (PUBMED:24412063) (PUBMED:15117943) ]. Besides being a subunit of the 26S proteasome, Sem1/DSS1 associates with other protein complexes [ (PUBMED:26944332) ]. It is a component of the nuclear pore complex (NPC)-associated TREX-2 complex that is required for transcription-coupled mRNA export, and the COP9 signalosome, which is involved in deneddylation [ (PUBMED:24896180) (PUBMED:19289793) (PUBMED:26456823) ].

Loss of DSS1 in humans has been associated with split hand/split foot malformations [ (PUBMED:8782053) ].

GO process:proteasome assembly (GO:0043248), mRNA export from nucleus (GO:0006406)
GO component:proteasome regulatory particle, lid subcomplex (GO:0008541)
Family alignment:
View or

There are 1265 DSS1_SEM1 domains in 1265 proteins in SMART's nrdb database.

Click on the following links for more information.