The domain within your query sequence starts at position 1346 and ends at position 1503; the E-value for the DUF1086 domain shown below is 4.05e-108.
YSVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFL NAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPRE GLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAE
DUF1086Domain of Unknown Function (DUF1086) |
---|
SMART accession number: | SM01146 |
---|---|
Description: | This family consists of several eukaryotic domains of unknown function which are present in chromodomain helicase DNA binding proteins. This domain is often found in conjunction with DEXDc (SM00487), HELICc (SM00490), DUF1087,CHROMO (SM00298) and PHD (SM00249). |
Interpro abstract (IPR009462): | This entry represents several eukaryotic domains of unknown function, which are present in chromodomain helicase DNA binding proteins. This domain is often found in conjunction with IPR000330 IPR001650 IPR009463 IPR000953 and IPR001965 . |
Family alignment: |
There are 1985 DUF1086 domains in 1982 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)