The domain within your query sequence starts at position 1359 and ends at position 1516; the E-value for the DUF1086 domain shown below is 4.05e-108.

YSVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFL
NAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPRE
GLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAE

DUF1086

Domain of Unknown Function (DUF1086)
DUF1086
SMART accession number:SM01146
Description: This family consists of several eukaryotic domains of unknown function which are present in chromodomain helicase DNA binding proteins. This domain is often found in conjunction with DEXDc (SM00487), HELICc (SM00490), DUF1087,CHROMO (SM00298) and PHD (SM00249).
Interpro abstract (IPR009462):

This entry represents several eukaryotic domains of unknown function, which are present in chromodomain helicase DNA binding proteins. This domain is often found in conjunction with IPR000330 IPR001650 IPR009463 IPR000953 and IPR001965 .

Family alignment:
View or

There are 1985 DUF1086 domains in 1982 proteins in SMART's nrdb database.

Click on the following links for more information.