The domain within your query sequence starts at position 17 and ends at position 336; the E-value for the DUF1693 domain shown below is 3.33e-241.
LNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRGRLEEAGINVQDVRLNGSAA GHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKE AYVQKLVKVCTDTDRWSLISLSNKNGRNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYD CSGNPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFR PADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFSDEERSKYDYLMILRRVVNE STVCLMGHERRQTLNLISLL
DUF1693Domain of unknown function (DUF1693) |
---|
SMART accession number: | SM01153 |
---|---|
Description: | This family contains many hypothetical proteins. It also includes four nematode prion-like proteins. This domain has been identified as part of the nucleotidyltransferase superfamily. |
Interpro abstract (IPR012937): | This entry includes terminal nucleotidyltransferase 5A/B/C/D (TENT5A/B/C/D). In general, they contain a NTase (nucleotidyltransferase) domain, some members possess additional C-terminal PAP/OAS1 substrate binding domain [ (PUBMED:19833706) ]. They are active non-canonical poly(A) polymerases, which modify cytosolic and/or nuclear RNA 3' ends [ (PUBMED:27060136) ]. They have different functions in many tissues at various stages of development. Human TENT5A is a SMAD signalling pathway related protein, where SMADs are intercellular effectors of transforming growth factor-beta (TGF-beta) [ (PUBMED:19833706) ]. The TENT5C gene is one of the most frequently mutated genes in multiple myeloma. TENT5C acts as an onco-suppressor in multiple myeloma [ (PUBMED:28931820) ]. TENT5C also seems to enhance replication of some viruses, including yellow fever virus, in response to type I interferon [ (PUBMED:17803723) ]. |
GO function: | RNA adenylyltransferase activity (GO:1990817) |
Family alignment: |
There are 1596 DUF1693 domains in 1586 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Links (links to other resources describing this domain)