The domain within your query sequence starts at position 127 and ends at position 160; the E-value for the DUF1713 domain shown below is 3.23e-11.
QCKNVLKIRRRKMNHHKYRKLVKRTRFLRRKVRE
DUF1713Mitochondrial domain of unknown function (DUF1713) |
---|
SMART accession number: | SM01155 |
---|---|
Description: | This domain is found at the C terminal end of mitochondrial proteins of unknown function. |
Interpro abstract (IPR013177): | This domain is found at the C-terminal end of mitochondrial mRNA-processing protein COX24, which is involved in the splicing of the COX1 mRNA [ (PUBMED:16339141) ]. It is also found in aurora-A kinase interacting protein (AIP) [ (PUBMED:17125467) ]. |
Family alignment: |
There are 1445 DUF1713 domains in 1445 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)