The domain within your query sequence starts at position 6 and ends at position 88; the E-value for the DUF1767 domain shown below is 4.85e-24.
GAALSQAGWYLSDEGVEACTSSPGKGSINDIILIALNTDLRTIGKKFLPSDINGGKVEKL EGPCVLQIQKVRNVAAPKDNEES
DUF1767 |
---|
SMART accession number: | SM01161 |
---|---|
Description: | Eukaryotic domain of unknown function. This domain is found to the N-terminus of the nucleic acid binding domain. |
Interpro abstract (IPR033472): | This is an eukaryotic domain of unknown function. This domain is found to the N terminus of the nucleic acid binding domain in RecQ mediated genome instability protein (RMI) [ (PUBMED:18923082) ]. |
Family alignment: |
There are 1940 DUF1767 domains in 1938 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)