The domain within your query sequence starts at position 377 and ends at position 423; the E-value for the DUF1856 domain shown below is 2e-16.
KFAKDDSDSMSRRQTSYSNNRSPTNSTGTWKDSPKSSKSIRFIPVST
DUF1856 |
---|
SMART accession number: | SM01164 |
---|---|
Description: | This domain has no known function. It is found in the C-terminal segment of various vasopressin receptors. |
Interpro abstract (IPR015076): | This protein has no known function. It is found in the C-terminal segment of various vasopressin receptors. |
Family alignment: |
There are 366 DUF1856 domains in 365 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)