The domain within your query sequence starts at position 377 and ends at position 423; the E-value for the DUF1856 domain shown below is 2e-16.

KFAKDDSDSMSRRQTSYSNNRSPTNSTGTWKDSPKSSKSIRFIPVST

DUF1856

DUF1856
SMART accession number:SM01164
Description: This domain has no known function. It is found in the C-terminal segment of various vasopressin receptors.
Interpro abstract (IPR015076):

This protein has no known function. It is found in the C-terminal segment of various vasopressin receptors.

Family alignment:
View or

There are 366 DUF1856 domains in 365 proteins in SMART's nrdb database.

Click on the following links for more information.