The domain within your query sequence starts at position 97 and ends at position 223; the E-value for the DUF3452 domain shown below is 4.59e-25.
IFIAAVDLDEMPFTFTELQKSIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALY SKLERTCELIYLTQPSSALSTEINSMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCV VDYFIKF
DUF3452Domain of unknown function (DUF3452) |
---|
SMART accession number: | SM01367 |
---|---|
Description: | This domain is functionally uncharacterised. This domain is found in bacteria and eukaryotes. |
Interpro abstract (IPR024599): | This domain is found in N-terminal of the retinoblastoma-associated protein. It is found in association with IPR002720 and IPR002719 . This domain is typically between 124 to 150 amino acids in length and has a single completely conserved residue W that may be functionally important. |
Family alignment: |
There are 1723 DUF3452 domains in 1722 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)