The domain within your query sequence starts at position 1 and ends at position 81; the E-value for the DUF3585 domain shown below is 2.82e-2.
MESGGTGKMDDIQLCKDIMDLKQELQNLVAIPEKEKTKLQKQREDELIQKIHRLVQKRDF LVDDAEVERLREQEEDKEMAD
DUF3585 |
|---|
| SMART accession number: | SM01203 |
|---|---|
| Description: | This domain is found in eukaryotes. This domain is typically between 135 and 149 amino acids in length and is found associated with the CH domain. |
| Family alignment: |
There are 6259 DUF3585 domains in 6259 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)
