The domain within your query sequence starts at position 1 and ends at position 110; the E-value for the DUF4205 domain shown below is 6.61e-7.
MSEVTKELLELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAF LLKKLLFSSEKSSWRDCSGH
DUF4205 |
---|
SMART accession number: | SM01174 |
---|---|
Description: | The proteins in this family are uncharacterized but often named FAM188B. |
Interpro abstract (IPR025257): | This is a conserved domain found in deubiquitinating enzymes, MINDY-3 and MINDY-4. Deubiquitinating enzymes (DUBs) remove ubiquitin (Ub) from Ub-conjugated substrates to regulate the functional outcome of ubiquitylation. This entry includes MINDY-3/4. They belong to the MINDY (motif interacting with Ub-containing novel DUB) family (peptidase family C121), whose members are deubiquitinating enzymes releasing Lys48-linked ubiquitin [ (PUBMED:27292798) ]. |
Family alignment: |
There are 1902 DUF4205 domains in 1902 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)