The domain within your query sequence starts at position 360 and ends at position 448; the E-value for the E2_bind domain shown below is 1.02e-40.

IQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTL
KELGLVDGQELAVADVTTPQTVLFKLHFT

E2_bind

E2_bind
SMART accession number:SM01181
Description: E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades. This is an E2 binding domain that is found on NEDD8 activating E1 enzyme. The domain resembles ubiquitin, and recruits the catalytic core of the E2 enzyme Ubc12 in a similar manner to that in which ubiquitin interacts with ubiquitin binding domains (PUBMED:15694336).
Interpro abstract (IPR014929):

E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades. This is an E2 binding domain that is found on NEDD8 activating E1 enzyme. The protein resembles ubiquitin, and recruits the catalytic core of the E2 enzyme Ubc12 in a similar manner to that in which ubiquitin interacts with ubiquitin binding domains [ (PUBMED:15694336) ].

GO process:protein neddylation (GO:0045116)
GO function:NEDD8 activating enzyme activity (GO:0019781)
Family alignment:
View or

There are 1533 E2_bind domains in 1532 proteins in SMART's nrdb database.

Click on the following links for more information.