The domain within your query sequence starts at position 452 and ends at position 538; the E-value for the EFG_C domain shown below is 9.13e-1.

LEPVVLGTVITPTEYTGKIMALCQARRAIQKNMTFIDENRVMLKYLFPLNEIVVDFYDSL
KSLSSGYASFDYEDAGYQTAELVKMDI

EFG_C

Elongation factor G C-terminus
EFG_C
SMART accession number:SM00838
Description: This domain includes the carboxyl terminal regions of Elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopt a ferredoxin-like fold.
Interpro abstract (IPR000640):

Elongation factor 2 (EF2 or EFG) is folded into five domains, with domains I and II forming the N-terminal block, domains IV and V forming the C-terminal block, and domain III providing the covalently-linked flexible connection between the two [ (PUBMED:11054294) ]. This entry represents the domain V of EF2 of both prokaryotes and eukaryotes (also known as eEF2). This domain is also found in elongation factor 4 and some tetracycline resistance proteins and adopts a ferredoxin-like fold [ (PUBMED:12471894) ].

Family alignment:
View or

There are 76176 EFG_C domains in 76171 proteins in SMART's nrdb database.

Click on the following links for more information.