The domain within your query sequence starts at position 54 and ends at position 88; the E-value for the EGF domain shown below is 1.47e1.
LCWSKPCHNDATCEDTVDSYICHCRPGSLIKDISE
EGFEpidermal growth factor-like domain. |
---|
SMART accession number: | SM00181 |
---|---|
Description: | - |
Interpro abstract (IPR000742): | A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [ (PUBMED:2288911) (PUBMED:6334307) (PUBMED:6607417) (PUBMED:3282918) ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. EGF is a polypeptide of about 50 amino acids with three internal disulfide bridges. It first binds with high affinity to specific cell-surface receptors and then induces their dimerization, which is essential for activating the tyrosine kinase in the receptor cytoplasmic domain, initiating a signal transduction that results in DNA synthesis and cell proliferation. A common feature of all EGF-like domains is that they are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF-like domain includes six cysteine residues which have been shown to be involved in disulfide bonds. The structure of several EGF-like domains has been solved. The fold consists of two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. |
Family alignment: |
There are 539475 EGF domains in 145300 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Taxonomic distribution of proteins containing EGF domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with EGF domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing EGF domain in the selected taxonomic class.
- Literature (relevant references for this domain)
-
Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.
- Rao Z, Handford P, Mayhew M, Knott V, Brownlee GG, Stuart D
- The structure of a Ca(2+)-binding epidermal growth factor-like domain: its role in protein-protein interactions.
- Cell. 1995; 82: 131-41
- Display abstract
Various diverse extracellular proteins possess Ca(2+)-binding epidermal growth factor (EGF)-like domains, the function of which remains uncertain. We have determined, at high resolution (1.5 A), the crystal structure of such a domain, from human clotting factor IX, as a complex with Ca2+. The Ca2+ ligands form a classic pentagonal bipyramid with six ligands contributed by one polypeptide chain and the seventh supplied by a neighboring EGF-like domain. The crystal structure identifies the role of Ca2+ in maintaining the conformation of the N-terminal region of the domain, but more importantly demonstrates that Ca2+ can directly mediate protein-protein contacts. The observed crystal packing of the domains provides a plausible model for the association of multiple tandemly linked EGF-like domains in proteins such as fibrillin-1, Notch, and protein S. This model is consistent with the known functional data and suggests a general biological role for these domains.
- Holmes WE et al.
- Identification of heregulin, a specific activator of p185erbB2.
- Science. 1992; 256: 1205-10
- Display abstract
The proto-oncogene designated erbB2 or HER2 encodes a 185-kilodalton transmembrane tyrosine kinase (p185erbB2), whose overexpression has been correlated with a poor prognosis in several human malignancies. A 45-kilodalton protein heregulin-alpha (HRG-alpha) that specifically induced phosphorylation of p185erbB2 was purified from the conditioned medium of a human breast tumor cell line. Several complementary DNA clones encoding related HRGs were identified, all of which are similar to proteins in the epidermal growth factor family. Scatchard analysis of the binding of recombinant HRG to a breast tumor cell line expressing p185erbB2 showed a single high affinity binding site [dissociation constant (Kd) = 105 +/- 15 picomolar]. Heregulin transcripts were identified in several normal tissues and cancer cell lines. The HRGs may represent the natural ligands for p185erbB2.
- Engel J
- EGF-like domains in extracellular matrix proteins: localized signals for growth and differentiation?
- FEBS Lett. 1989; 251: 1-7
- Display abstract
Multidomain proteins of the extracellular matrix (ECM) play an important role in development and maintenance of cellular organization and in tissue repair. Several ECM proteins such as laminin, tenascin and thrombospondin contain domains with homology to epidermal growth factor (EGF) and exhibit growth promoting activity. The mitogenic activity of laminin is restricted to a fragment which consists of about 25 repeating domains with partial homology to EGF and comprises the rod-like inner regions of the three short arms of the four armed molecule. The mitogenic activity does not correlate with promotion of cell attachment and neurite outgrowth for which major functional sites have been found in other regions of the laminin molecule. It is suggested that EGF-like domains in laminin, in other ECM proteins and in the extracellular portions of some membrane proteins are signals for cellular growth and differentiation. Because they are integral parts of large molecules and often of supramolecular assemblies these domains are well suited to stimulate neighboring cells in a specific and vectorial way. This concept of localized growth or differentiation signals offers an attractive mechanism for the regulation of cellular development.
- Appella E, Weber IT, Blasi F
- Structure and function of epidermal growth factor-like regions in proteins.
- FEBS Lett. 1988; 231: 1-4
- Doolittle RF, Feng DF, Johnson MS
- Computer-based characterization of epidermal growth factor precursor.
- Nature. 1984; 307: 558-60
- Display abstract
The cDNA sequence of the precursor of mouse epidermal growth factor (EGFP) has recently been reported by two groups, both of whom noted the presence of repeated similar segments, each about 40 residues long. One of these repeat units overlaps with the sequence of epidermal growth factor itself. The sequence of epidermal growth factor has been reported to be similar to that of pancreatic secretory trypsin inhibitor (PSTI) and a somewhat better match has been found with part of the sequence of bovine factor X, one of the blood coagulating factors. We report here that there is an even stronger similarity between the sequences of some of the repeat units of epidermal growth factor precursor and certain segments in factor X. This sequence similarity is also apparent in comparisons with other blood coagulation factors. On the basis of these sequence comparisons we suggest a scheme for the evolution of the epidermal growth factor precursor. We have also identified certain structural features in the precursor sequence that bear on the way in which the mature epidermal growth factor is generated.
- Disease (disease genes where sequence variants are found in this domain)
-
SwissProt sequences and OMIM curated human diseases associated with missense mutations within the EGF domain.
Protein Disease EGF-containing fibulin-like extracellular matrix protein 1 (Q12805) (SMART) OMIM:601548: Doyne honeycomb degeneration of retina
OMIM:126600:
OMIM:126600: Doyne honeycomb retinal dystrophyVitamin K-dependent protein C (P04070) (SMART) OMIM:176860: Thrombophilia due to protein C deficiency ; Purpura fulminans, neonatal Thyroid peroxidase (P07202) (SMART) OMIM:274500: Thyroid iodine peroxidase deficiency ; Goiter, congenital ; Hypothyroidism, congenital Low-density lipoprotein receptor (P01130) (SMART) OMIM:143890: Hypercholesterolemia, familial Coagulation factor IX (P00740) (SMART) OMIM:306900: Hemophilia B ; Warfarin sensitivity Fibrillin-1 (P35555) (SMART) OMIM:134797: Marfan syndrome
OMIM:154700: Shprintzen-Goldberg syndrome
OMIM:182212: Ectopia lentis, familial ; MASS syndrome
OMIM:604308:Coagulation factor VII (P08709) (SMART) OMIM:227500: Factor VII deficiency ; {Myocardial infarction, decreased susceptibility to} Delta-like protein 3 (Q9NYJ7) (SMART) OMIM:602768: Spondylocostal dysostosis, autosomal recessive, 1
OMIM:277300:Fibrillin-2 (P35556) (SMART) OMIM:121050: Contractural arachnodactyly, congenital Vitamin K-dependent protein S (P07225) (SMART) OMIM:176880: Protein S deficiency - Metabolism (metabolic pathways involving proteins which contain this domain)
-
Click the image to view the interactive version of the map in iPath% proteins involved KEGG pathway ID Description 10.89 map04512 ECM-receptor interaction 10.51 map04510 Focal adhesion 9.08 map04610 Complement and coagulation cascades 9.08 map04330 Notch signaling pathway 8.17 map04012 ErbB signaling pathway 7.00 map04514 Cell adhesion molecules (CAMs) 4.02 map04350 TGF-beta signaling pathway 3.63 map04320 Dorso-ventral axis formation 3.37 map04810 Regulation of actin cytoskeleton 3.24 map04360 Axon guidance 2.85 map04310 Wnt signaling pathway 2.20 map04340 Hedgehog signaling pathway 2.08 map00590 Arachidonic acid metabolism 1.95 map00531 Glycosaminoglycan degradation 1.95 map01032 Glycan structures - degradation 1.82 map05212 Pancreatic cancer 1.82 map05214 Glioma 1.82 map05223 Non-small cell lung cancer 1.82 map05215 Prostate cancer 1.30 map04060 Cytokine-cytokine receptor interaction 1.17 map05217 Basal cell carcinoma 1.04 map05219 Bladder cancer 1.04 map05120 Epithelial cell signaling in Helicobacter pylori infection 1.04 map05213 Endometrial cancer 1.04 map04010 MAPK signaling pathway 1.04 map04912 GnRH signaling pathway 1.04 map04540 Gap junction 1.04 map05218 Melanoma 0.78 map05010 Alzheimer's disease 0.78 map05211 Renal cell carcinoma 0.52 map05222 Small cell lung cancer 0.26 map04670 Leukocyte transendothelial migration 0.13 map00350 Tyrosine metabolism 0.13 map04140 Regulation of autophagy 0.13 map04640 Hematopoietic cell lineage 0.13 map00562 Inositol phosphate metabolism 0.13 map04070 Phosphatidylinositol signaling system This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with EGF domain which could be assigned to a KEGG orthologous group, and not all proteins containing EGF domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.
- Structure (3D structures containing this domain)
3D Structures of EGF domains in PDB
PDB code Main view Title 1a3p ROLE OF THE 6-20 DISULFIDE BRIDGE IN THE STRUCTURE AND ACTIVITY OF EPIDERMAL GROWTH FACTOR, NMR, 20 STRUCTURES 1adx FIFTH EGF-LIKE DOMAIN OF THROMBOMODULIN (TMEGF5), NMR, 14 STRUCTURES 1cqe PROSTAGLANDIN H2 SYNTHASE-1 COMPLEX WITH FLURBIPROFEN 1cvu CRYSTAL STRUCTURE OF ARACHIDONIC ACID BOUND TO THE CYCLOOXYGENASE ACTIVE SITE OF COX-2 1cvw Crystal structure of active site-inhibited human coagulation factor VIIA (DES-GLA) 1cx2 CYCLOOXYGENASE-2 (PROSTAGLANDIN SYNTHASE-2) COMPLEXED WITH A SELECTIVE INHIBITOR, SC-558 1ddx CRYSTAL STRUCTURE OF A MIXTURE OF ARACHIDONIC ACID AND PROSTAGLANDIN BOUND TO THE CYCLOOXYGENASE ACTIVE SITE OF COX-2: PROSTAGLANDIN STRUCTURE 1diy CRYSTAL STRUCTURE OF ARACHIDONIC ACID BOUND IN THE CYCLOOXYGENASE ACTIVE SITE OF PGHS-1 1dqb NMR STRUCTURE OF THROMBOMODULIN EGF(4-5) 1dx5 Crystal structure of the thrombin-thrombomodulin complex 1ebv OVINE PGHS-1 COMPLEXED WITH SALICYL HYDROXAMIC ACID 1egf SOLUTION STRUCTURE OF MURINE EPIDERMAL GROWTH FACTOR DETERMINED BY NMR SPECTROSCOPY AND REFINED BY ENERGY MINIMIZATION WITH RESTRAINTS 1epg THREE-DIMENSIONAL NUCLEAR MAGNETIC RESONANCE STRUCTURES OF MOUSE EPIDERMAL GROWTH FACTOR IN ACIDIC AND PHYSIOLOGICAL PH SOLUTIONS 1eph THREE-DIMENSIONAL NUCLEAR MAGNETIC RESONANCE STRUCTURES OF MOUSE EPIDERMAL GROWTH FACTOR IN ACIDIC AND PHYSIOLOGICAL PH SOLUTIONS 1epi THREE-DIMENSIONAL NUCLEAR MAGNETIC RESONANCE STRUCTURES OF MOUSE EPIDERMAL GROWTH FACTOR IN ACIDIC AND PHYSIOLOGICAL PH SOLUTIONS 1epj THREE-DIMENSIONAL NUCLEAR MAGNETIC RESONANCE STRUCTURES OF MOUSE EPIDERMAL GROWTH FACTOR IN ACIDIC AND PHYSIOLOGICAL PH SOLUTIONS 1eqg THE 2.6 ANGSTROM MODEL OF OVINE COX-1 COMPLEXED WITH IBUPROFEN 1eqh THE 2.7 ANGSTROM MODEL OF OVINE COX-1 COMPLEXED WITH FLURBIPROFEN 1esl INSIGHT INTO E-SELECTIN(SLASH)LIGAND INTERACTION FROM THE CRYSTAL STRUCTURE AND MUTAGENESIS OF THE LEC(SLASH)EGF DOMAINS 1fe2 CRYSTAL STRUCTURE OF DIHOMO-GAMMA-LINOLEIC ACID BOUND IN THE CYCLOOXYGENASE CHANNEL OF PROSTAGLANDIN ENDOPEROXIDE H SYNTHASE-1. 1fjs CRYSTAL STRUCTURE OF THE INHIBITOR ZK-807834 (CI-1031) COMPLEXED WITH FACTOR XA 1fsb STRUCTURE OF THE EGF DOMAIN OF P-SELECTIN, NMR, 19 STRUCTURES 1g1q Crystal structure of P-selectin lectin/EGF domains 1g1r Crystal structure of P-selectin lectin/EGF domains complexed with SLeX 1g1s P-SELECTIN LECTIN/EGF DOMAINS COMPLEXED WITH PSGL-1 PEPTIDE 1g1t CRYSTAL STRUCTURE OF E-SELECTIN LECTIN/EGF DOMAINS COMPLEXED WITH SLEX 1gk5 Solution Structure the mEGF/TGFalpha44-50 chimeric growth factor 1gl4 Nidogen-1 G2/Perlecan IG3 Complex 1hae HEREGULIN-ALPHA EPIDERMAL GROWTH FACTOR-LIKE DOMAIN, NMR, 20 STRUCTURES 1haf HEREGULIN-ALPHA EPIDERMAL GROWTH FACTOR-LIKE DOMAIN, NMR, MINIMIZED AVERAGE STRUCTURE 1hcg STRUCTURE OF HUMAN DES(1-45) FACTOR XA AT 2.2 ANGSTROMS RESOLUTION 1hre SOLUTION STRUCTURE OF THE EPIDERMAL GROWTH FACTOR-LIKE DOMAIN OF HEREGULIN-ALPHA, A LIGAND FOR P180ERB4 1hrf SOLUTION STRUCTURE OF THE EPIDERMAL GROWTH FACTOR-LIKE DOMAIN OF HEREGULIN-ALPHA, A LIGAND FOR P180ERB4 1ht5 THE 2.75 ANGSTROM RESOLUTION MODEL OF OVINE COX-1 COMPLEXED WITH METHYL ESTER FLURBIPROFEN 1ht8 THE 2.7 ANGSTROM RESOLUTION MODEL OF OVINE COX-1 COMPLEXED WITH ALCLOFENAC 1igx Crystal Structure of Eicosapentanoic Acid Bound in the Cyclooxygenase Channel of Prostaglandin Endoperoxide H Synthase-1. 1igz Crystal Structure of Linoleic acid Bound in the Cyclooxygenase Channel of Prostaglandin Endoperoxide H Synthase-1. 1ijq Crystal Structure of the LDL Receptor YWTD-EGF Domain Pair 1iox NMR Structure of human Betacellulin-2 1ip0 NMR STRUCTURE OF HUMAN BETACELLULIN-2 1ivo Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor Extracellular Domains. 1j9c Crystal Structure of tissue factor-factor VIIa complex 1jbu Coagulation Factor VII Zymogen (EGF2/Protease) in Complex with Inhibitory Exosite Peptide A-183 1jl9 Crystal Structure of Human Epidermal Growth Factor 1k36 NMR Structure of human Epiregulin 1k37 NMR Structure of human Epiregulin 1kig BOVINE FACTOR XA 1kli Cofactor-and substrate-assisted activation of factor VIIa 1klj Crystal structure of uninhibited factor VIIa 1mox Crystal Structure of Human Epidermal Growth Factor Receptor (residues 1-501) in complex with TGF-alpha 1mq5 Crystal Structure of 3-chloro-N-[4-chloro-2-[[(4-chlorophenyl)amino]carbonyl]phenyl]-4-[(4-methyl-1-piperazinyl)methyl]-2-thiophenecarboxamide Complexed with Human Factor Xa 1mq6 Crystal Structure of 3-chloro-N-[4-chloro-2-[[(5-chloro-2-pyridinyl)amino]carbonyl]-6-methoxyphenyl]-4-[[(4,5-dihydro-2-oxazolyl)methylamino]methyl]-2-thiophenecarboxamide Complexed with Human Factor Xa 1nql Structure of the extracellular domain of human epidermal growth factor (EGF) receptor in an inactive (low pH) complex with EGF. 1p9j Solution structure and dynamics of the EGF/TGF-alpha chimera T1E 1pge PROSTAGLANDIN H2 SYNTHASE-1 COMPLEXED WITH P-(2'-IODO-5'-THENOYL)HYDROTROPIC ACID (IODOSUPROFEN) 1pgf PROSTAGLANDIN H2 SYNTHASE-1 COMPLEXED WITH 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYLINDOLE-3-ACETIC ACID (IODOINDOMETHACIN), CIS MODEL 1pgg PROSTAGLANDIN H2 SYNTHASE-1 COMPLEXED WITH 1-(4-IODOBENZOYL)-5-METHOXY-2-METHYLINDOLE-3-ACETIC ACID (IODOINDOMETHACIN), TRANS MODEL 1prh THE X-RAY CRYSTAL STRUCTURE OF THE MEMBRANE PROTEIN PROSTAGLANDIN H2 SYNTHASE-1 1pth THE STRUCTURAL BASIS OF ASPIRIN ACTIVITY INFERRED FROM THE CRYSTAL STRUCTURE OF INACTIVATED PROSTAGLANDIN H2 SYNTHASE 1pxx CRYSTAL STRUCTURE OF DICLOFENAC BOUND TO THE CYCLOOXYGENASE ACTIVE SITE OF COX-2 1q4g 2.0 Angstrom Crystal Structure of Ovine Prostaglandin H2 Synthase-1, in complex with alpha-methyl-4-biphenylacetic acid 1qfk STRUCTURE OF HUMAN FACTOR VIIA AND ITS IMPLICATIONS FOR THE TRIGGERING OF BLOOD COAGULATION 1rfn HUMAN COAGULATION FACTOR IXA IN COMPLEX WITH P-AMINO BENZAMIDINE 1tpg F1-G MODULE PAIR RESIDUES 1-91 (C83S) OF TISSUE-TYPE PLASMINOGEN ACTIVATOR (T-PA) (NMR, 298K, PH2.95, REPRESENTATIVE STRUCTURE) 1u67 Crystal Structure of Arachidonic Acid Bound to a Mutant of Prostagladin H Synthase-1 that Forms Predominantly 11-HPETE. 1v3x Factor Xa in complex with the inhibitor 1-[6-methyl-4,5,6,7-tetrahydrothiazolo(5,4-c)pyridin-2-yl] carbonyl-2-carbamoyl-4-(6-chloronaphth-2-ylsulphonyl)piperazine 1w7x Factor7 - 413 complex 1w8b Factor7 - 413 complex 1xdt COMPLEX OF DIPHTHERIA TOXIN AND HEPARIN-BINDING EPIDERMAL GROWTH FACTOR 1xfe Solution structure of the LA7-EGFA pair from the LDL receptor 1ygc Short Factor VIIa with a small molecule inhibitor 1yo8 Structure of the C-terminal domain of human thrombospondin-2 1yuf TYPE ALPHA TRANSFORMING GROWTH FACTOR, NMR, 16 MODELS WITHOUT ENERGY MINIMIZATION 1yug TYPE ALPHA TRANSFORMING GROWTH FACTOR, NMR, 15 MODELS AFTER ECEPP/3 ENERGY MINIMIZATION 1z1y Crystal structure of Methylated Pvs25, an ookinete protein from Plasmodium vivax 1z27 Crystal structure of Native Pvs25, an ookinete protein from Plasmodium vivax. 1z3g Crystal structure of complex between Pvs25 and Fab fragment of malaria transmission blocking antibody 2A8 1z6e Factor XA in complex with the inhibitor 1-(3'-amino-1,2-benzisoxazol-5'-yl)-n-(4-(2'-((dimethylamino)methyl)-1h-imidazol-1-yl)-2-fluorophenyl)-3-(trifluoromethyl)-1h-pyrazole-5-carboxamide (razaxaban; DPC906; BMS-561389) 1zaq FOURTH EGF-LIKE DOMAIN OF THROMBOMODULIN, NMR, 12 STRUCTURES 2adx FIFTH EGF-LIKE DOMAIN OF THROMBOMODULIN (TMEGF5), NMR, MINIMIZED AVERAGE STRUCTURE 2ayl 2.0 Angstrom Crystal Structure of Manganese Protoporphyrin IX-reconstituted Ovine Prostaglandin H2 Synthase-1 Complexed With Flurbiprofen 2bmg Crystal structure of factor Xa in complex with 50 2bok Factor Xa - cation 2bq6 Crystal structure of factor Xa in complex with 21 2bq7 Crystal structure of factor Xa in complex with 43 2bqw CRYSTAL STRUCTURE OF FACTOR XA IN COMPLEX WITH COMPOUND 45 2bz6 Orally available Factor7a inhibitor 2d1j Factor Xa in complex with the inhibitor 2-[[4-[(5-chloroindol-2-yl)sulfonyl]piperazin-1-yl] carbonyl]thieno[3,2-b]pyridine n-oxide 2ddu Crystal structure of the third repeat domain of reelin 2e26 Crystal structure of two repeat fragment of reelin 2ei6 FACTOR XA IN COMPLEX WITH THE INHIBITOR (-)-cis-N1-[(5-Chloroindol-2-yl)carbonyl]-N2-[(5-methyl-4,5,6,7-tetrahydrothiazolo[5,4-c]pyridin-2-yl)carbonyl]-1,2-cyclohexanediamine 2ei7 FACTOR XA IN COMPLEX WITH THE INHIBITOR trans-N1-[(5-Chloroindol-2-yl)carbonyl]-N2-[(5-methyl-4,5,6,7-tetrahydrothiazolo[5,4-c]pyridin-2-yl)carbonyl]-1,2-cyclohexanediamine 2ei8 FACTOR XA IN COMPLEX WITH THE INHIBITOR (1S,2R,4S)-N1-[(5-chloroindol-2-yl)carbonyl]-4-(N,N-dimethylcarbamoyl)-N2-[(5-methyl-4,5,6,7-tetrahydrothiazolo[5,4-c]pyridin-2-yl)carbonyl]-1,2-cyclohexanediamine 2fzz Factor Xa in complex with the inhibitor 1-(3-amino-1,2-benzisoxazol-5-yl)-6-(2'-(((3r)-3-hydroxy-1-pyrrolidinyl)methyl)-4-biphenylyl)-3-(trifluoromethyl)-1,4,5,6-tetrahydro-7h-pyrazolo[3,4-c]pyridin-7-one 2g00 Factor Xa in complex with the inhibitor 3-(6-(2'-((dimethylamino)methyl)-4-biphenylyl)-7-oxo-3-(trifluoromethyl)-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-c]pyridin-1-yl)benzamide 2gd4 Crystal Structure of the Antithrombin-S195A Factor Xa-Pentasaccharide Complex 2gy5 Tie2 Ligand-Binding Domain Crystal Structure 2gy7 Angiopoietin-2/Tie2 Complex Crystal Structure 2i9a Crystal structure of the free aminoterminal fragment of urokinase type plasminogen activator (ATF) 2i9b Crystal structure of ATF-urokinase receptor complex 2jkh Factor Xa - cation inhibitor complex 2k2s structure of the MIC1-GLD/MIC6-EGF complex from Toxoplasma gondii 2k2t Epidermal growth Factor-like domain 2 from Toxoplasma gondii Microneme protein 6 2kv4 EGF 2m74 1H, 13C and 15N assignments of the four N-terminal domains of human fibrillin-1 2oye Indomethacin-(R)-alpha-ethyl-ethanolamide bound to Cyclooxygenase-1 2oyu Indomethacin-(S)-alpha-ethyl-ethanolamide bound to Cyclooxygenase-1 2p16 Factor Xa in Complex with the Inhibitor APIXABAN (BMS-562247) AKA 1-(4-METHOXYPHENYL)-7-OXO-6-(4-(2-OXO-1-PIPERIDINYL)PHENYL)-4,5,6,7-TETRAHYDRO-1H-PYRAZOLO[3, 4-C]PYRIDINE-3-CARBOXAMIDE 2p3f Crystal structure of the factor Xa/NAP5 complex 2p3t Crystal structure of human factor XA complexed with 3-Chloro-4-(2-methylamino-imidazol-1-ylmethyl)-thiophene-2-carboxylic acid [4-chloro-2-(5-chloro-pyridin-2-ylcarbamoyl)-6-methoxy-phenyl]-amide 2p3u Crystal structure of human factor XA complexed with 3-chloro-N-(4-chloro-2-{[(5-chloropyridin-2-yl)amino]carbonyl}-6-methoxyphenyl)-4-[(1-methyl-1H-imidazol-2-yl)methyl]thiophene-2-carboxamide {Pfizer 320663} 2p93 Factor xa in complex with the inhibitor 5-chloro-N-(2-(4-(2-oxopyridin-1(2H)-yl)benzamido)ethyl)thiophene-2-carboxamide 2p94 Factor xa in complex with the inhibitor 3-chloro-N-((1R,2S)-2-(4-(2-oxopyridin-1(2H)-yl)benzamido)cyclohexyl)-1H-indole-6-carboxamide 2p95 Factor xa in complex with the inhibitor 5-chloro-N-((1R,2S)-2-(4-(2-oxopyridin-1(2H)-YL)benzamido) cyclopentyl)thiophene-2-carboxamide 2pe4 Structure of Human Hyaluronidase 1, a Hyaluronan Hydrolyzing Enzyme Involved in Tumor Growth and Angiogenesis 2phb An Orally Efficacious Factor Xa Inhibitor 2pr3 Factor XA inhibitor 2puq Crystal structure of active site inhibited coagulation factor VIIA in complex with soluble tissue factor 2q1j The discovery of glycine and related amino acid-based factor xa inhibitors 2ra0 X-ray Structure of FXa in complex with 7-fluoroindazole 2rhp The Thrombospondin-1 Polymorphism Asn700Ser Associated with Cornoary Artery Disease Causes Local and Long-Ranging Changes in Protein Structure 2rnl Solution structure of the EGF-like domain from human Amphiregulin 2tgf THE SOLUTION STRUCTURE OF HUMAN TRANSFORMING GROWTH FACTOR ALPHA 2vvc Aminopyrrolidine Factor Xa inhibitor 2vvu Aminopyrrolidine Factor Xa inhibitor 2vvv Aminopyrrolidine-related triazole Factor Xa inhibitor 2vwl Aminopyrrolidine Factor Xa inhibitor 2vwm Aminopyrrolidine Factor Xa inhibitor 2vwn Aminopyrrolidine Factor Xa inhibitor 2vwo Aminopyrrolidine Factor Xa inhibitor 2w26 Fator Xa in complex with BAY59-7939 2w3i Crystal Structure of FXa in complex with 4,4-disubstituted pyrrolidine-1,2-dicarboxamide inhibitor 2 2w3k Crystal Structure of FXa in complex with 4,4-disubstituted pyrrolidine-1,2-dicarboxamide inhibitor 1 2wft Crystal structure of the human HIP ectodomain 2wfx Crystal structure of the complex between human hedgehog-interacting protein HIP and Sonic Hedgehog in the presence of calcium 2wg3 Crystal structure of the complex between human hedgehog-interacting protein HIP and desert hedgehog without calcium 2wg4 Crystal structure of the complex between human hedgehog-interacting protein HIP and sonic hedgehog without calcium 2wph factor IXa superactive triple mutant 2wpi factor IXa superactive double mutant 2wpj factor IXa superactive triple mutant, NaCl-soaked 2wpk factor IXa superactive triple mutant, ethylene glycol-soaked 2wpl factor IXa superactive triple mutant, EDTA-soaked 2wpm factor IXa superactive mutant, EGR-CMK inhibited 2xbv Factor Xa in complex with a pyrrolidine-3,4-dicarboxylic acid inhibitor 2xbw Factor Xa in complex with a pyrrolidine-3,4-dicarboxylic acid inhibitor 2xbx Factor Xa in complex with a pyrrolidine-3,4-dicarboxylic acid inhibitor 2xby Factor Xa in complex with a pyrrolidine-3,4-dicarboxylic acid inhibitor 2xc0 Factor Xa in complex with a pyrrolidine-3,4-dicarboxylic acid inhibitor 2xc4 Factor Xa in complex with a pyrrolidine-3,4-dicarboxylic acid inhibitor 2xc5 Factor Xa in complex with a pyrrolidine-3,4-dicarboxylic acid inhibitor 2y5f FACTOR XA - CATION INHIBITOR COMPLEX 2y5g FACTOR XA - CATION INHIBITOR COMPLEX 2y5h FACTOR XA - CATION INHIBITOR COMPLEX 2ygo WIF domain-EGF-like domain 1 of human Wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine 2ygp WIF domain-EGF-like domain 1 Met77Trp of human Wnt inhibitory factor 1 in complex with 1,2-dipalmitoylphosphatidylcholine 2ygq WIF domain-epidermal growth factor (EGF)-like domains 1-3 of human Wnt inhibitory factor 1 in complex with 1,2- dipalmitoylphosphatidylcholine 3a7q Structural basis for specific recognition of reelin by its receptors 3asi Alpha-Neurexin-1 ectodomain fragment; LNS5-EGF3-LNS6 3bt1 Structure of urokinase receptor, urokinase and vitronectin complex 3bt2 Structure of urokinase receptor, urokinase and vitronectin complex 3c9a High Resolution Crystal Structure of Argos bound to the EGF domain of Spitz 3ca7 High Resolution Crystal Structure of the EGF domain of Spitz 3cen Factor XA in complex with the inhibitor N-(2-(((5-chloro-2-pyridinyl) amino)sulfonyl)phenyl)-4-(2-oxo-1(2H)-pyridinyl)benzamide 3cfw L-selectin lectin and EGF domains 3cs7 FACTOR XA IN COMPLEX WITH THE INHIBITOR 1-(4-methoxyphenyl)-6-(4-(1-(pyrrolidin-1-ylmethyl)cyclopropyl)phenyl)-3-(trifluoromethyl)-5,6-dihydro-1H-pyrazolo[3,4-c]pyridin-7(4H)-one 3e50 Crystal structure of human insulin degrading enzyme in complex with transforming growth factor-alpha 3egf SOLUTION STRUCTURE OF MURINE EPIDERMAL GROWTH FACTOR DETERMINED BY NMR SPECTROSCOPY AND REFINED BY ENERGY MINIMIZATION WITH RESTRAINTS 3f1s Crystal structure of Protein Z complexed with protein Z-dependent inhibitor 3f6u Crystal structure of human Activated Protein C (APC) complexed with PPACK 3fby The crystal structure of the signature domain of cartilage oligomeric matrix protein. 3ffg Factor XA in complex with the inhibitor (R)-6-(2'-((3- HYDROXYPYRROLIDIN-1-YL)METHYL)BIPHENYL-4-YL)-1-(3-(5-OXO-4,5-DIHYDRO-1H-1,2,4-TRIAZOL-3-YL)PHENYL)-3-(TRIFLUOROMETHYL)-5,6-DIHYDRO-1H-PYRAZOLO[3,4-C]PYRIDIN- 7(4H)-ONE 3g5c Structural and biochemical studies on the ectodomain of human ADAM22 3gis Crystal Structure of Na-free Thrombin in Complex with Thrombomodulin 3h5c X-Ray Structure of Protein Z-Protein Z Inhibitor Complex 3ho3 Crystal structure of Hedgehog-interacting protein (HHIP) 3ho4 Crystal structure of Hedgehog-interacting protein (HHIP) 3ho5 Crystal structure of Hedgehog-interacting protein (HHIP) and Sonic hedgehog (SHH) complex 3hs5 X-ray crystal structure of arachidonic acid bound to the cyclooxygenase channel of cyclooxygenase-2 3hs6 X-ray crystal structure of eicosapentaenoic acid bound to the cyclooxygenase channel of cyclooxygenase-2 3hs7 X-ray crystal structure of docosahexaenoic acid bound to the cyclooxygenase channel of cyclooxygenase-2 3iit Factor XA in complex with a cis-1,2-diaminocyclohexane derivative 3kcg Crystal structure of the antithrombin-factor IXa-pentasaccharide complex 3kk6 Crystal Structure of Cyclooxygenase-1 in complex with celecoxib 3kl6 Discovery of Tetrahydropyrimidin-2(1H)-one derivative TAK-442: A potent, selective and orally active factor Xa inhibitor 3kqb Factor xa in complex with the inhibitor n-(3-fluoro-2'- (methylsulfonyl)biphenyl-4-yl)-1-(3-(5-oxo-4,5-dihydro-1h- 1,2,4-triazol-3-yl)phenyl)-3-(trifluoromethyl)-1h- pyrazole-5-carboxamide 3kqc Factor xa in complex with the inhibitor 6-(2'- (methylsulfonyl)biphenyl-4-yl)-1-(3-(5-oxo-4,5-dihydro-1h- 1,2,4-triazol-3-yl)phenyl)-3-(trifluoromethyl)-5,6- dihydro-1h-pyrazolo[3,4-c]pyridin-7(4h)-one 3kqd Factor xa in complex with the inhibitor 1-(3-(5-oxo-4,5- dihydro-1h-1,2,4-triazol-3-yl)phenyl)-6-(2'-(pyrrolidin-1- ylmethyl)biphenyl-4-yl)-3-(trifluoromethyl)-5,6-dihydro- 1h-pyrazolo[3,4-c]pyridin-7(4h)-one 3kqe Factor xa in complex with the inhibitor 3-methyl-1-(3-(5- oxo-4,5-dihydro-1h-1,2,4-triazol-3-yl)phenyl)-6-(2'- (pyrrolidin-1-ylmethyl)biphenyl-4-yl)-5,6-dihydro-1h- pyrazolo[3,4-c]pyridin-7(4h)-one 3krk X-ray crystal structure of arachidonic acid bound in the cyclooxygenase channel of L531F murine COX-2 3lc3 Benzothiophene Inhibitors of Factor IXa 3lc5 Selective Benzothiophine Inhibitors of Factor IXa 3liw Factor XA in complex with (R)-2-(1-ADAMANTYLCARBAMOYLAMINO)-3-(3-CARBAMIDOYL-PHENYL)-N-PHENETHYL-PROPIONIC ACID AMIDE 3ln0 Structure of compound 5c-S bound at the active site of COX-2 3ln1 Structure of celecoxib bound at the COX-2 active site 3ltf Crystal Structure of the Drosophila Epidermal Growth Factor Receptor ectodomain in complex with Spitz 3ltg Crystal structure of the Drosophila Epidermal Growth Factor Receptor ectodomain complexed with a low affinity Spitz mutant 3m36 Factor XA in complex with the inhibitor 1-[3-(aminomethyl)phenyl]-N-[3-fluoro-2'-(methylsulfonyl)biphenyl-4-yl]-3-(trifluoromethyl)-1H-pyrazole-5-carboxamide (DPC423) 3m37 Factor XA in complex with the inhibitor 1-[2-(aminomethyl)phenyl]-N-(3-fluoro-2'-sulfamoylbiphenyl-4-yl)-3-(trifluoromethyl)-1H-pyrazole-5-carboxamide (DPC602) 3mdl X-ray crystal structure of 1-arachidonoyl glycerol bound to the cyclooxygenase channel of cyclooxygenase-2 3mqe Structure of SC-75416 bound at the COX-2 active site 3n8v Crystal Structure of Unoccupied Cyclooxygenase-1 3n8w Crystal Structure of R120Q/Native Cyclooxygenase-1 Heterodimer mutant in complex with Flurbiprofen 3n8x Crystal Structure of Cyclooxygenase-1 in Complex with Nimesulide 3n8y Structure of Aspirin Acetylated Cyclooxygenase-1 in Complex with Diclofenac 3n8z Crystal Structure of Cyclooxygenase-1 in Complex with Flurbiprofen 3njp The Extracellular and Transmembrane Domain Interfaces in Epidermal Growth Factor Receptor Signaling 3nt1 High resolution structure of naproxen:COX-2 complex. 3ntb Structure of 6-methylthio naproxen analog bound to mCOX-2. 3ntg Crystal structure of COX-2 with selective compound 23d-(R) 3olt X-ray crystal structure of arachidonic acid bound to the cyclooxygenase channel of R513H murine COX-2 3olu X-ray crystal structure of 1-arachidonoyl glycerol bound to the cyclooxygenase channel of R513H murine COX-2 3pgh CYCLOOXYGENASE-2 (PROSTAGLANDIN SYNTHASE-2) COMPLEXED WITH A NON-SELECTIVE INHIBITOR, FLURBIPROFEN 3poy Crystal Structure of the alpha-Neurexin-1 ectodomain, LNS 2-6 3q3k Factor Xa in complex with a phenylenediamine derivative 3q7d Structure of (R)-naproxen bound to mCOX-2. 3qcw Structure of neurexin 1 alpha (domains LNS1-LNS6), no splice inserts 3qh0 X-ray crystal structure of palmitic acid bound to the cyclooxygenase channel of cyclooxygenase-2 3qmo X-ray crystal structure of NS-398 bound to the cyclooxygenase channel of cyclooxygenase-2 3r05 Structure of neurexin 1 alpha (domains LNS1-LNS6), with splice insert SS3 3rr3 Structure of (R)-flurbiprofen bound to mCOX-2 3s2k Structural basis of Wnt signaling inhibition by Dickkopf binding to LRP5/6. 3s8v Crystal structure of LRP6-Dkk1 complex 3s8z Crystal structure of LRP6-E3E4 3s94 Crystal structure of LRP6-E1E2 3sob The structure of the first YWTD beta propeller domain of LRP6 in complex with a FAB 3soq The structure of the first YWTD beta propeller domain of LRP6 in complex with a DKK1 peptide 3sov The structure of a beta propeller domain in complex with peptide S 3tgf THE SOLUTION STRUCTURE OF HUMAN TRANSFORMING GROWTH FACTOR ALPHA 3tk5 Factor Xa in complex with D102-4380 3tk6 factor Xa in complex with D46-5241 3tzi X-ray crystal structure of arachidonic acid bound in the cyclooxygenase channel of G533V murine COX-2 3u73 Crystal structure of stabilized human uPAR mutant in complex with ATF 3u7u Crystal structure of extracellular region of human epidermal growth factor receptor 4 in complex with neuregulin-1 beta 3v64 Crystal Structure of agrin and LRP4 4a0p Crystal structure of LRP6P3E3P4E4 4bdw The structure of the FnI-EGF tandem domain of coagulation factor XII in complex with Holmium 4bdx The structure of the FnI-EGF tandem domain of coagulation factor XII 4c16 4C16 4cox CYCLOOXYGENASE-2 (PROSTAGLANDIN SYNTHASE-2) COMPLEXED WITH A NON-SELECTIVE INHIBITOR, INDOMETHACIN 4csy 4CSY 4dg6 Crystal structure of domains 1 and 2 of LRP6 4e1g X-ray crystal structure of alpha-linolenic acid bound to the cyclooxygenase channel of cyclooxygenase-2 4fm5 X-ray structure of des-methylflurbiprofen bound to murine COX-2 4ish Structure of FACTOR VIIA in complex with the inhibitor BMS-593214 also known as 2'-[(6R,6AR,11BR)-2-CARBAMIMIDOYL-6,6A,7,11B-TETRAHYDRO-5H-INDENO[2,1-C]QUINOLIN-6-YL]-5'-HYDROXY-4'-METHOXYBIPHENYL-4-CARBOXYLIC ACID 4isi Structure of FACTOR VIIA in complex with the inhibitor (6S)-N-(4-CARBAMIMIDOYLBENZYL)-1-CHLORO-3-(CYCLOBUTYLAMINO)-8,8-DIETHYL-4-OXO-4,6,7,8-TETRAHYDROPYRROLO[1,2-A]PYRAZINE-6-CARBOXAMIDE 4jyu Structure of factor VIIA in complex with the inhibitor (2R)-2-[(1-AMINOISOQUINOLIN-6-YL)AMINO]-2-[3-ETHOXY-4-(PROPAN-2-YLOXY)PHENYL]-N-(PHENYLSULFONYL)ETHANAMIDE 4jyv Structure of factor VIIA in complex with the inhibitor (2R)-2-[3-ETHOXY-4-(PROPAN-2-YLOXY)PHENYL]-2-(ISOQUINOLIN-6-YLAMINO)-N-[(3-SULFAMOYLPHENYL)SULFONYL]ETHANAMIDE 4jzd Structure of factor VIIA in complex with the inhibitor 2-{2-[(4-carbamimidoylphenyl)carbamoyl]-6-methoxypyridin-3-yl}-5-{[(2S)-1-hydroxy-3,3-dimethylbutan-2-yl]carbamoyl}benzoic acid 4jze Structure of factor VIIA in complex with the inhibitor 2-{2-[(1-aminoisoquinolin-6-yl)carbamoyl]-6-methoxypyridin-3-yl}-5-{[(2S)-1-hydroxy-3,3-dimethylbutan-2-yl]carbamoyl}benzoic acid 4jzf Structure of factor VIIA in complex with the inhibitor 2-{2-[(3-carbamoylphenyl)carbamoyl]-6-methoxypyridin-3-yl}-5-{[(2S)-1-hydroxy-3,3-dimethylbutan-2-yl]carbamoyl}benzoic acid 4k0v Structural basis for angiopoietin-1 mediated signaling initiation 4k24 Structure of anti-uPAR Fab ATN-658 in complex with uPAR 4m10 Crystal Structure of Murine Cyclooxygenase-2 Complex with Isoxicam 4m11 Crystal Structure of Murine Cyclooxygenase-2 Complex with Meloxicam 4na9 Factor VIIa in complex with the inhibitor 3'-amino-5'-[(2s,4r)-6-carbamimidoyl-4-phenyl-1,2,3,4-tetrahydroquinolin-2-yl]biphenyl-2-carboxylic acid 4ng9 Factor viia in complex with the inhibitor (2R)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-n-(3-sulfamoylbenzyl)ethanamide 4nga Factor viia in complex with the inhibitor (2R)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-N-[2-(propan-2-ylsulfonyl)benzyl]ethanamide 4o1z Crystal Structure of Ovine Cyclooxygenase-1 Complex with Meloxicam 4otj 4OTJ 4oty Crystal structure of lumiracoxib bound to the apo-mouse-cyclooxygenase-2 4ph9 4PH9 4rrw 4RRW 4rrx 4RRX 4rry 4RRY 4rrz 4RRZ 4rs0 4RS0 4rut 4RUT 4tgf SOLUTION STRUCTURES OF HUMAN TRANSFORMING GROWTH FACTOR ALPHA DERIVED FROM 1*H NMR DATA 4x8s 4X8S 4x8t 4X8T 4x8u 4X8U 4x8v 4X8V 4xl1 4XL1 4xlw 4XLW 4yt6 4YT6 4yt7 4YT7 4yzu 4YZU 4z0k 4Z0K 4z0l 4Z0L 4z6a 4Z6A 4z80 4Z80 4z81 4Z81 4zae 4ZAE 4zxx 4ZXX 4zxy 4ZXY 5cox UNINHIBITED MOUSE CYCLOOXYGENASE-2 (PROSTAGLANDIN SYNTHASE-2) 5e8d 5E8D 5egm 5EGM 5f19 5F19 5f1a 5F1A 5fdq 5FDQ 5fww 5FWW 5i46 5I46 5ikq 5IKQ 5ikr 5IKR 5ikt 5IKT 5ikv 5IKV 5jvy 5JVY 5jvz 5JVZ 5jw1 5JW1 5k0h 5K0H 5kir 5KIR 5kn5 5KN5 5l2y 5L2Y 5l2z 5L2Z 5l30 5L30 6cox CYCLOOXYGENASE-2 (PROSTAGLANDIN SYNTHASE-2) COMPLEXED WITH A SELECTIVE INHIBITOR, SC-558 IN I222 SPACE GROUP - Links (links to other resources describing this domain)
-
INTERPRO IPR000742 PFAM EGF PROSITE EGF_1