The domain within your query sequence starts at position 688 and ends at position 722; the E-value for the EGF domain shown below is 9.6e-2.

TCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCN

EGF

Epidermal growth factor-like domain.
EGF
SMART accession number:SM00181
Description: -
Interpro abstract (IPR000742):

A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [ (PUBMED:2288911) (PUBMED:6334307) (PUBMED:6607417) (PUBMED:3282918) ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. EGF is a polypeptide of about 50 amino acids with three internal disulfide bridges. It first binds with high affinity to specific cell-surface receptors and then induces their dimerization, which is essential for activating the tyrosine kinase in the receptor cytoplasmic domain, initiating a signal transduction that results in DNA synthesis and cell proliferation.

A common feature of all EGF-like domains is that they are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF-like domain includes six cysteine residues which have been shown to be involved in disulfide bonds. The structure of several EGF-like domains has been solved. The fold consists of two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet.

Family alignment:
View or

There are 539475 EGF domains in 145300 proteins in SMART's nrdb database.

Click on the following links for more information.