The domain within your query sequence starts at position 6 and ends at position 171; the E-value for the EXOIII domain shown below is 6.23e-47.

All catalytic sites are present in this domain. Check the literature (PubMed 11937058 ) for details.

EVVAMDCEMVGLGPQRVSGLARCSIVNIHGAVLYDKYIRPEGEITDYRTQVSGVTPQHMV
RATPFGEARLEILQLLKGKLVVGHDLKHDFNALKEDMSKYTIYDTSTDRLLWHEAKLQYY
SRVSLRLLCKRLLHKNIQNNWRGHCSVEDARATMELYKISQRLRAQ

EXOIII

EXOIII
SMART accession number:SM00479
Description: exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases
Interpro abstract (IPR013520):

This entry includes a variety of exonuclease proteins, such as ribonuclease T [ (PUBMED:8506149) ] and the epsilon subunit of DNA polymerase III. Ribonuclease T is responsible for the end-turnover of tRNA,and removes the terminal AMP residue from uncharged tRNA. DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria, and also exhibits 3' to 5' exonuclease activity.

Family alignment:
View or

There are 66161 EXOIII domains in 66129 proteins in SMART's nrdb database.

Click on the following links for more information.