The domain within your query sequence starts at position 384 and ends at position 430; the E-value for the FA domain shown below is 1.9e-17.
KGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERSSSKRYTMSRS
FA
FERM adjacent (FA)
SMART accession number:
SM01195
Description:
This region is found adjacent to Band 4.1 / FERM domains in a subset of FERM containing protein. The region has been hypothesised to play a role in regulatory adaptation, based on similarity to other protein kinase (PUBMED:16626485). .
This region is found adjacent to Band 4.1 / FERM domains ( IPR000299 ) in a subset of FERM containing protein. The region has been hypothesised to play a role in regulatory adaptation, based on similarity to other protein kinase substrates [ (PUBMED:16626485) ].
Family alignment:
There are 11691 FA domains in 11679 proteins in SMART's nrdb database.
Click on the following links for more information.
Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing FA domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with FA domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing FA domain in the selected taxonomic class.
Literature (relevant references for this domain)
Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.
A FERM-adjacent (FA) region defines a subset of the 4.1 superfamily and is apotential regulator of FERM domain function.
BMC Genomics. 2006; 7: 85-85
Display abstract
BACKGROUND: Proteins containing FERM domains comprise a diverse group ofeukaryotic proteins that bind membrane proteins and lipids. In doing so, theyorganise membrane microstructure, and coordinate the disposition of signallingand cell adhesion complexes. In protein 4.1R, phosphorylation adjacent to theFERM domain regulates its activity, and membrane mechanical properties. RESULTS: A novel sequence domain has been detected in a subset of proteins that containFERM domains. This subset includes the true 4.1 proteins, some tyrosinephosphatases, rho-GEF proteins and type II transmembrane proteins, as well assome uncharacterised FERM proteins. This FERM-adjacent region is always closelyproximate to the C-terminal of the FERM domain. This sequence is likely to befolded with elements of alpha and beta structure. The FERM-adjacent region of4.1R contains serine residues phosphorylated by PKC and PKA; these appearconserved in about half of all other FERM-adjacent regions. Phylogenetic analysesindicate that all proteins containing a FERM-adjacent region arose from a single ancestor after FERM domains had started to proliferate in genomes of animals,plants and mycetozoa. CONCLUSION: The FERM-adjacent region defines a subset ofthe FERM proteins in animals. The conservation of motifs in this region that are potential substrates for kinases together with the known regulatoryphosphorylation of 4.1R in this region raises the possibility that theFERM-adjacent region is a regulatory adaptation in this subset of the FERMproteins.
Links (links to other resources describing this domain)
