SMART: FANCL_C domain annotation

FSMDCGICYARHLNGAIPDQVCNNPQCGQPFHEICLYEWLRGLSTSRQSFNVFFGDCPYC
SKPITLKMS

FANCL_C FANCL C-terminal domain

SMART accession number:	SM01197
Description:	This domain is found at the C-terminus of the Fancl protein in humans which is the putative E3 ubiquitin ligase subunit of the FA complex (Fanconi anaemia). Eight subunits of the Fanconi anaemia gene products form a multisubunit nuclear complex which is required for mono-ubiquitination of a downstream FA protein, FANCD2.
Family alignment:	View or

There are 701 FANCL_C domains in 701 proteins in SMART's nrdb database.

Click on the following links for more information.

Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing FANCL_C domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with FANCL_C domain is also avaliable.

Click on the protein counts, or double click on taxonomic names to display all proteins containing FANCL_C domain in the selected taxonomic class.
Cellular role (predicted cellular role)
Cellular role: interaction
Structure (3D structures containing this domain)
3D Structures of FANCL_C domains in PDB
PDB code Main view Title
3k1l Crystal Structure of FANCL

4ccg Structure of an E2-E3 complex
Links (links to other resources describing this domain)
PFAM FANCL_C

PDB code	Main view	Title
3k1l		Crystal Structure of FANCL
4ccg		Structure of an E2-E3 complex

FANCL_C