The domain within your query sequence starts at position 270 and ends at position 324; the E-value for the FF domain shown below is 2.36e-14.

REKAKQAFKELLRDKAVPSNASWEQAMKMVVTDPRYSALPKLSEKKQAFNAYKAQ

FF

Contains two conserved F residues
FF
SMART accession number:SM00441
Description: A novel motif that often accompanies WW domains. Often contains two conserved Phe (F) residues.
Interpro abstract (IPR002713):

The FF domain may be involved in protein-protein interaction [ (PUBMED:10390614) ]. It often occurs as multiple copies and often accompanies WW domains IPR001202 . PRP40 from yeast encodes a novel, essential splicing component that associates with the yeast U1 small nuclear ribonucleoprotein particle [ (PUBMED:8622699) ].

Family alignment:
View or

There are 19195 FF domains in 4383 proteins in SMART's nrdb database.

Click on the following links for more information.