The domain within your query sequence starts at position 520 and ends at position 574; the E-value for the FF domain shown below is 1.53e-4.

LLLAKEEFKKLLEESKVSPRTTFKEFAEKHGRDQRFRLVQKRKDQEHFFNQFILI

FF

Contains two conserved F residues

• SMART accession number: SM00441
• Description: A novel motif that often accompanies WW domains. Often contains two conserved Phe (F) residues.
• Interpro abstract (IPR002713):

  The FF domain may be involved in protein-protein interaction [ (PUBMED:10390614) ]. It often occurs as multiple copies and often accompanies WW domains IPR001202 . PRP40 from yeast encodes a novel, essential splicing component that associates with the yeast U1 small nuclear ribonucleoprotein particle [ (PUBMED:8622699) ].

There are 19195 FF domains in 4383 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Bedford MT, Leder P
• The FF domain: a novel motif that often accompanies WW domains.
• Trends Biochem Sci. 1999; 24: 264-5

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
50.00	map04510	Focal adhesion
50.00	map04670	Leukocyte transendothelial migration

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with FF domain which could be assigned to a KEGG orthologous group, and not all proteins containing FF domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of FF domains in PDB

PDB code	Title
1uzc	THE STRUCTURE OF AN FF DOMAIN FROM HUMAN HYPA/FBP11
2b7e	First FF domain of Prp40 Yeast Protein
2cqn	Solution structure of the FF domain of human Formin-binding protein 3
2dod	Solution structure of the first FF domain of human transcription factor CA150
2doe	Solution structure of the third FF domain of human transcription factor CA150
2dof	Solution structure of the fourth FF domain of human transcription factor CA150
2e71	Solution structure of the second FF domain of human transcription factor CA150
2juc	URN1 FF domain yeast
2k85	p190-A RhoGAP FF1 domain
2kfd	Prp40 FF4 domain
2kiq	Solution structure of the FF Domain 2 of human transcription elongation factor CA150
2kis	Solution structure of CA150 FF1 domain and FF1-FF2 interdomain linker
2kzg	A Transient and Low Populated Protein Folding Intermediate at Atomic Resolution
2l9v	NMR structure of the FF domain L24A mutant's folding transition state
2lks	Ff11-60
3hfh	Crystal structure of tandem FF domains
4fqg	Crystal structure of the TCERG1 FF4-6 tandem repeat domain

Links (links to other resources describing this domain)

• INTERPRO: IPR002713