The domain within your query sequence starts at position 231 and ends at position 365; the E-value for the FIST_C domain shown below is 2.61e-6.
ASNYLHRVVSTFSDMNIILAGGQVDNLSSLTCEKNPLDIDATGVVGLSFSGHRIQSATVL LTEDVNDAKTVEAAMQRLKAANIPEQNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPS VPLFGFFGNGEIGCD
FIST_C |
---|
SMART accession number: | SM01204 |
---|---|
Description: | The FIST C domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids. PMID:17855421 |
Interpro abstract (IPR019494): | This entry represents a novel sensory domain, designated FIST_C (short for F-box and intracellular signal transduction, C-terminal), which is present in signal transduction proteins from bacteria, archaea and eukaryotes. The chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids [ (PUBMED:17855421) ]. |
Family alignment: |
There are 7371 FIST_C domains in 7366 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Links (links to other resources describing this domain)