The domain within your query sequence starts at position 85 and ends at position 128; the E-value for the FU domain shown below is 1.98e-8.

ANRCKKCGATCESCFSQDFCIRCKRRFHLYKGKCLPSCPPGTLT

FU

Furin-like repeats
FU
SMART accession number:SM00261
Description: -
Interpro abstract (IPR006212):

The furin-like cysteine rich region has been found in a variety of proteins from eukaryotes that are involved in the mechanism of signal transduction by receptor tyrosine kinases, which involves receptor aggregation [ (PUBMED:1936959) (PUBMED:23756652) ].

Family alignment:
View or

There are 66474 FU domains in 13497 proteins in SMART's nrdb database.

Click on the following links for more information.