The domain within your query sequence starts at position 1928 and ends at position 2049; the E-value for the G8 domain shown below is 1.15e-48.

HSWFPQRVPHDGDSVTVETGHLLLLDANTSFLNSLHIKGGKLIFMDPGPIELRAHSILIT
DGGELHIGSEEKPFQGKARIKIYGSVHSTPFFPYGVKFLAVRNGTLSLHGSVPEVTVTYL
QA

G8

G8
SMART accession number:SM01225
Description: This domain is found in disease proteins PKHD1 and KIAA1199 and is named G8 after its 8 conserved glycines. It is predicted to contain 10 beta strands and an alpha helix.
Interpro abstract (IPR019316):

This entry represents a domain found in disease proteins PKHD1 and KIAA1199 and is named G8 after its 8 conserved glycines. It is predicted to contain 10 beta strands and an alpha helix [ (PUBMED:16632497) ].

Family alignment:
View or

There are 2452 G8 domains in 1853 proteins in SMART's nrdb database.

Click on the following links for more information.