The domain within your query sequence starts at position 2183 and ends at position 2303; the E-value for the G8 domain shown below is 2.37e-59.
SSWGGSPPPEEGSLAVITKGQIILLDQSTPILKMLLIQGGTLIFDEANIELQAENILITD
GGVLQIGTEASPFQHRAVITLHGHLRSPELPVYGAKTLGVREGTLDLHGLPIPVVWTRLT
H
G8
SMART accession number:
SM01225
Description:
This domain is found in disease proteins PKHD1 and KIAA1199 and is named G8 after its 8 conserved glycines. It is predicted to contain 10 beta strands and an alpha helix.
This entry represents a domain found in disease proteins PKHD1 and KIAA1199 and is named G8 after its 8 conserved glycines. It is predicted to contain 10 beta strands and an alpha helix [ (PUBMED:16632497) ].
Family alignment:
There are 2452 G8 domains in 1853 proteins in SMART's nrdb database.
Click on the following links for more information.
Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing G8 domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with G8 domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing G8 domain in the selected taxonomic class.
Literature (relevant references for this domain)
Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.
G8: a novel domain associated with polycystic kidney disease and non-syndromichearing loss.
Bioinformatics. 2006; 22: 2189-91
Display abstract
We report a novel protein domain-G8-which contains five repeated beta-strandpairs and is present in some disease-related proteins such as PKHD1, KIAA1199,TMEM2 as well as other uncharacterized proteins. Most G8-containing proteins are predicted to be membrane-integral or secreted. The G8 domain may be involved inextracellular ligand binding and catalysis. It has been reported that mis-sensemutations in the two G8 domains of human PKHD1 protein resulted in a less stable protein and are associated with autosomal-recessive polycystic kidney disease,indicating the importance of the domain structure. G8 is also present in theN-terminus of some non-syndromic hearing loss disease-related proteins such asKIAA1109 and TMEM2. Discovery of G8 domain will be important for the research of the structure/function of related proteins and beneficial for the development of novel therapeutics. Contact: liangsp@hunnu.edu.cn
Links (links to other resources describing this domain)