The domain within your query sequence starts at position 41 and ends at position 122; the E-value for the GDNF domain shown below is 1.33e-15.

CTQARKKCEANPACKAAYQHLGSCTSSLSRPLPLEESAMSADCLEAAEQLRNSSLIDCRC
HRRMKHQATCLDIYWTVHPARS

GDNF

GDNF/GAS1 domain
GDNF
SMART accession number:SM00907
Description: This cysteine rich domain is found in multiple copies in GNDF and GAS1 proteins. GDNF and neurturin (NTN) receptors are potent survival factors for sympathetic, sensory and central nervous system neurons (PUBMED:16551639), (PUBMED:9192899). GDNF and neurturin promote neuronal survival by signaling through similar multicomponent receptors that consist of a common receptor tyrosine kinase and a member of a GPI-linked family of receptors that determines ligand specificity (PUBMED:9192898).
Interpro abstract (IPR016017):

This cysteine rich domain is found in multiple copies in GNDF and GAS1 proteins. GDNF and neurturin (NTN) receptors are potent survival factors for sympathetic, sensory and central nervous system neurons [ (PUBMED:16551639) (PUBMED:9192899) ]. GDNF and neurturin promote neuronal survival by signalling through similar multicomponent receptors that consist of a common receptor tyrosine kinase and a member of a GPI-linked family of receptors that determines ligand specificity [ (PUBMED:9192898) ].

Family alignment:
View or

There are 7226 GDNF domains in 2899 proteins in SMART's nrdb database.

Click on the following links for more information.