The domain within your query sequence starts at position 222 and ends at position 352; the E-value for the GLECT domain shown below is 5.38e-60.
IPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQIN NSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEV AGDIQLTHVQT
GLECTGalectin |
---|
SMART accession number: | SM00276 |
---|---|
Description: | Galectin - galactose-binding lectin |
Interpro abstract (IPR001079): | Galectins (also known as galaptins or S-lectin) are a family of proteins defined by having at least one characteristic carbohydrate recognition domain (CRD) with an affinity for beta-galactosides and sharing certain sequence elements. Members of the galectins family are found in mammals, birds, amphibians, fish, nematodes, sponges, and some fungi. Galectins are known to carry out intra- and extracellular functions through glycoconjugate-mediated recogntion. From the cytosol they may be secreted by non-classical pathways, but they may also be targeted to the nucleus or specific sub-cytosolic sites. Within the same peptide chain some galectins have a CRD with only a few additional amino acids, whereas others have two CRDs joined by a link peptide, and one (galectin-3) has one CRD joined to a different type of domain [ (PUBMED:16051274) (PUBMED:14758066) ]. The galectin carbohydrate recognition domain (CRD) is a beta-sandwich of about 135 amino acid. The two sheets are slightly bent with 6 strands forming the concave side and 5 strands forming the convex side. The concave side forms a groove in which carbohydrate is bound, and which is long enough to hold about a linear tetrasaccharide [ (PUBMED:8262940) (PUBMED:8747464) ]. |
GO function: | carbohydrate binding (GO:0030246) |
Family alignment: |
There are 9997 GLECT domains in 7376 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Taxonomic distribution of proteins containing GLECT domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with GLECT domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing GLECT domain in the selected taxonomic class.
- Metabolism (metabolic pathways involving proteins which contain this domain)
-
Click the image to view the interactive version of the map in iPath% proteins involved KEGG pathway ID Description 100.00 map00564 Glycerophospholipid metabolism This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with GLECT domain which could be assigned to a KEGG orthologous group, and not all proteins containing GLECT domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.
- Structure (3D structures containing this domain)
3D Structures of GLECT domains in PDB
PDB code Main view Title 1a3k X-RAY CRYSTAL STRUCTURE OF THE HUMAN GALECTIN-3 CARBOHYDRATE RECOGNITION DOMAIN (CRD) AT 2.1 ANGSTROM RESOLUTION 1a78 COMPLEX OF TOAD OVARY GALECTIN WITH THIO-DIGALACTOSE 1bkz CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 1c1f LIGAND-FREE CONGERIN I 1c1l LACTOSE-LIGANDED CONGERIN I 1g86 CHARCOT-LEYDEN CRYSTAL PROTEIN/N-ETHYLMALEIMIDE COMPLEX 1gan COMPLEX OF TOAD OVARY GALECTIN WITH N-ACETYLGALACTOSE 1gzw X-RAY CRYSTAL STRUCTURE OF HUMAN GALECTIN-1 1hdk Charcot-Leyden Crystal Protein - pCMBS Complex 1hlc X-RAY CRYSTAL STRUCTURE OF THE HUMAN DIMERIC S-LAC LECTIN, L-14-II, IN COMPLEX WITH LACTOSE AT 2.9 ANGSTROMS RESOLUTION 1is3 LACTOSE AND MES-LIGANDED CONGERIN II 1is4 LACTOSE-LIGANDED CONGERIN II 1is5 Ligand free Congerin II 1is6 MES-Liganded Congerin II 1kjl High Resolution X-Ray Structure of Human Galectin-3 in complex with LacNAc 1kjr Crystal Structure of the human galectin-3 CRD in complex with a 3'-derivative of N-Acetyllactosamine 1lcl CHARCOT-LEYDEN CRYSTAL PROTEIN 1qkq CHARCOT-LEYDEN CRYSTAL PROTEIN - MANNOSE COMPLEX 1qmj CG-16, a homodimeric agglutinin from chicken liver 1sla X-RAY CRYSTALLOGRAPHY REVEALS CROSSLINKING OF MAMMALIAN LECTIN (GALECTIN-1) BY BIANTENNARY COMPLEX TYPE SACCHARIDES 1slb X-RAY CRYSTALLOGRAPHY REVEALS CROSSLINKING OF MAMMALIAN LECTIN (GALECTIN-1) BY BIANTENNARY COMPLEX TYPE SACCHARIDES 1slc X-RAY CRYSTALLOGRAPHY REVEALS CROSSLINKING OF MAMMALIAN LECTIN (GALECTIN-1) BY BIANTENNARY COMPLEX TYPE SACCHARIDES 1slt STRUCTURE OF S-LECTIN, A DEVELOPMENTALLY REGULATED VERTEBRATE BETA-GALACTOSIDE BINDING PROTEIN 1ul9 CGL2 ligandfree 1ulc CGL2 in complex with lactose 1uld CGL2 in complex with blood group H type II 1ule CGL2 in complex with linear B2 trisaccharide 1ulf CGL2 in complex with Blood Group A tetrasaccharide 1ulg CGL2 in complex with Thomsen-Friedenreich antigen 1w6m X-RAY CRYSTAL STRUCTURE OF C2S HUMAN GALECTIN-1 COMPLEXED WITH GALACTOSE 1w6n X-RAY CRYSTAL STRUCTURE OF C2S HUMAN GALECTIN-1 1w6o X-RAY CRYSTAL STRUCTURE OF C2S HUMAN GALECTIN-1 COMPLEXED WITH LACTOSE 1w6p X-RAY CRYSTAL STRUCTURE OF C2S HUMAN GALECTIN-1 COMPLEXED WITH N- Acetyl-LACTOSAMINE 1w6q X-RAY CRYSTAL STRUCTURE OF R111H HUMAN GALECTIN-1 1wlc Congerin II Y16S/T88I double mutant 1wld Congerin II T88I single mutant 1wlw Congerin II Y16S single mutant 1ww4 Agrocybe cylindracea galectin complexed with NeuAca2-3lactose 1ww5 Agrocybe cylindracea galectin complexed with 3'-sulfonyl lactose 1ww6 Agrocybe cylindracea galectin complexed with lactose 1ww7 Agrocybe cylindracea galectin (Ligand-free) 1x50 Solution structure of the C-terminal gal-bind lectin domain from human galectin-4 2d6k Crystal structure of mouse galectin-9 N-terminal CRD (crystal form 1) 2d6l Crystal structure of mouse galectin-9 N-terminal CRD (crystal form 2) 2d6m Crystal structure of mouse galectin-9 N-terminal CRD in complex with lactose 2d6n Crystal structure of mouse galectin-9 N-terminal CRD in complex with N-acetyllactosamine 2d6o Crystal structure of mouse galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer 2d6p Crystal structure of mouse galectin-9 N-terminal CRD in complex with T-antigen 2dyc Crystal structure of the N-terminal domain of mouse galectin-4 2eak Crystal structure of human galectin-9 N-terminal CRD in complex with lactose 2eal Crystal structure of human galectin-9 N-terminal CRD in complex with Forssman pentasaccharide 2gal CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 IN COMPLEX WITH GALACTOSE 2jj6 Crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein 2km2 Galectin-1 dimer 2nmn Crystal structure of human galectin-3 carbohydrate-recognising domain at 2.45 angstrom resolution 2nmo Crystal structure of human galectin-3 carbohydrate-recognition domain at 1.35 angstrom resolution 2nn8 Crystal structure of human galectin-3 carbohydrate-recognition domain with lactose bound, at 1.35 angstrom resolution 2wkk Identification of the glycan target of the nematotoxic fungal galectin CGL2 in Caenorhabditis elegans 2wsu Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre 2wsv Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre complexed with lactose 2wt0 Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre complexed with N-acetyl-lactosamine 2wt1 Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre complexed with lacto-N-neo-tetraose 2wt2 Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre complexed with tri(N-acetyl-lactosamine) 2xg3 Human galectin-3 in complex with a benzamido-N-acetyllactoseamine inhibitor 2ymz Crystal structure of chicken Galectin 2 2yro Solution structure of the C-terminal Gal-bind lectin protein from Human Galectin-8 2yv8 Crystal structure of N-terminal domain of human galectin-8 2yxs Crystal Sturcture of N-terminal domain of human galectin-8 with D-lactose 2yy1 Crystal sturcture of N-terminal domain of human galectin-9 containing L-acetyllactosamine 2zgk Crystal structure of wildtype AAL 2zgl Crystal structure of recombinant Agrocybe aegerita (rAAL) 2zgm Crystal structure of recombinant Agrocybe aegerita lectin,rAAL, complex with lactose 2zgn crystal structure of recombinant Agrocybe aegerita lectin, rAAL, complex with galactose 2zgo Crystal structure of AAL mutant H59Q complex with lactose 2zgp Crystal structure of Agrocybe aegerita lectin AAL mutant I25G 2zgq Crystal structure of AAL mutant L33A in P1 spacegroup 2zgr Crystal structure of AAL mutant L33A in C2 spacegroup 2zgs Crystal structure of Agrocybe aegerita lectin AAL mutant L47A 2zgt Crystal structure of Agrocybe aegerita lectin AAL mutant F93G 2zgu Crystal structure Agrocybe aegerita lectin AAL mutant I144G 2zhk Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer (crystal 1) 2zhl Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer (crystal 2) 2zhm Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine trimer (crystal 1) 2zhn Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine trimer (crystal 2) 2zkn X-ray structure of mutant galectin-1/lactose complex 3afk Crystal Structure of Agrocybe aegerita lectin AAL complexed with Thomsen-Friedenreich antigen 3ajy Crystal Structure of Ancestral Congerin Con-anc 3ajz Crystal Structure of Ancestral Congerin Con-anc 3ak0 Crystal Structure of Ancestral Congerin Con-anc'-N28K 3ap4 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with lactose 3ap5 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain 3ap6 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with lactose 3'-sulfate 3ap7 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with lactose sialic acid 3ap9 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with Lacto-N-fucopentaose III 3apb Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with iodide 3aya Crystal structure of galectin-3 CRD domian complexed with Thomsen-Friedenreich antigen 3ayc Crystal structure of galectin-3 CRD domian complexed with GM1 pentasaccharide 3ayd Crystal structure of galectin-3 CRD domian complexed with TFN 3aye Crystal structure of galectin-3 CRD domian complexed with lactose 3b9c Crystal Structure of Human GRP CRD 3dui Crystal structure of the oxidized CG-1B: an adhesion/growth-regulatory lectin from chicken 3gal CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 IN COMPLEX WITH GALACTOSAMINE 3i8t N-terminal CRD1 domain of mouse Galectin-4 in complex with lactose 3lsd N-Domain of human adhesion/growth-regulatory galectin-9 3lse N-Domain of human adhesion/growth-regulatory galectin-9 in complex with lactose 3m2m Rat galectin-1 complex with lactose 3m3c Crystal Structure of Agrocybe aegerita lectin AAL complexed with p-Nitrophenyl TF disaccharide 3m3e Crystal Structure of Agrocybe aegerita lectin AAL mutant E66A complexed with p-Nitrophenyl Thomsen-Friedenreich disaccharide 3m3o Crystal Structure of Agrocybe aegerita lectin AAL mutant R85A complexed with p-Nitrophenyl TF disaccharide 3m3q Crystal Structure of Agrocybe aegerita lectin AAL complexed with Ganglosides GM1 pentasaccharide 3nv1 Crystal structure of human galectin-9 C-terminal CRD 3nv2 Crystal structure of human galectin-9 C-terminal CRD in complex with N-acetyllactosamine 3nv3 Crystal structure of human galectin-9 C-terminal CRD in complex with biantennary oligosaccharide 3nv4 Crystal structure of human galectin-9 C-terminal CRD in complex with Sialyllactose 3ojb Crystal structure of C-terminal domain of human galectin-8 3oy8 Crystal structure of human galectin-1 in complex with lactobionic acid 3oyw Crystal structure of human galectin-1 in complex with thiodigalactoside 3t1l Crystal structure of human Galectin-3 in complex with methyl 2-O-acetyl-3-O-toluoyl-beta-D-talopyranoside 3t1m Crystal structure of human galectin-3 carbohydrate recognition domain in complex with methyl 3-deoxy-2-O-toluoyl-3-N-toluoyl-beta-D-talopyranoside 3t2t Crystal structure of human galectin-1 in complex with methyl 2-O-acetyl-3-O-toluoyl-beta-D-talopyranoside 3vkl Protease-resistant mutant form of human Galectin-8 in complex with two lactose molecules 3vkm Protease-resistant mutant form of Human Galectin-8 in complex with sialyllactose and lactose 3vkn Galectin-8 N-terminal domain in free form 3vko Galectin-8 N-terminal domain in complex with sialyllactosamine 3vv1 Crystal Structure of Caenorhabditis elegans galectin LEC-6 3w58 Crystal structure of Galectin-1 in the lactose-unbound state(P21) 3w59 Crystal structure of Galectin-1 in the lactose-unbound state(P212121) 3wg1 Crystal structure of Agrocybe cylindracea galectin with lactose 3wg2 Crystal structure of Agrocybe cylindracea galectin mutant (N46A) 3wg3 Crystal structure of Agrocybe cylindracea galectin with blood type A antigen tetraose 3wg4 Crystal structure of Agrocybe cylindracea galectin mutant (N46A) with blood type A antigen tetraose 3wlu 3WLU 3wuc 3WUC 3wud 3WUD 3wv6 3WV6 3zsj Crystal structure of Human Galectin-3 CRD in complex with Lactose at 0.86 angstrom resolution 3zsk Crystal structure of Human Galectin-3 CRD with glycerol bound at 0.90 angstrom resolution 3zsl Crystal structure of Apo Human Galectin-3 CRD at 1.08 angstrom resolution, at cryogenic temperature 3zsm Crystal structure of Apo Human Galectin-3 CRD at 1.25 angstrom resolution, at room temperature 3zxe Crystal structure of Human Galectin-7 in complex with a galactose- benzylphosphate inhibitor 3zxf High resolution structure of Human Galectin-7 4agg Structure of a tetrameric galectin from Cinachyrella sp. (Ball sponge) 4agr Structure of a tetrameric galectin from Cinachyrella sp. (Ball sponge) 4agv Structure of a tetrameric galectin from Cinachyrella sp. (Ball sponge) 4bli Galectin-3c in complex with Bisamido-thiogalactoside derivate 1 4blj Galectin-3c in complex with Bisamido-thiogalactoside derivate 2 4bm8 Galectin-3c in complex with Bisamido-thiogalactoside derivate 3 4bmb Crystal structure of the N terminal domain of human Galectin 8 4bme Crystal structure of the N terminal domain of human Galectin 8, F19Y mutant 4fqz Crystal structure of a protease-resistant mutant form of human galectin-8 4ga9 Crystal Structure of Rat Galectin-1 in Complex with Lactose 4gal CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 IN COMPLEX WITH LACTOSE 4gxl The crystal structure of Galectin-8 C-CRD in complex with NDP52 4han Crystal structure of Galectin 8 with NDP52 peptide 4hl0 Crystal structure of full-length Toxascaris leonina galectin 4jc1 Galectin-3 carbohydrate recognition domain in complex with thiodigalactoside 4jck Galectin-3 carbohydrate recognition domain in complex with thioditaloside 4lbj Crystal structure of Human galectin-3 CRD K176L mutant in complex with LNT 4lbk Crystal structure of Human galectin-3 CRD K176L mutant in complex with LNnT 4lbl Crystal structure of Human galectin-3 CRD K176L mutant in complex with a-GM3 4lbm Crystal structure of Human galectin-3 CRD in complex with LNT 4lbn Crystal structure of Human galectin-3 CRD in complex with LNnT 4lbo Crystal structure of Human galectin-3 CRD in complex with a-GM3 4lbq 4LBQ 4no4 4NO4 4q1p 4Q1P 4q1r 4Q1R 4q26 4Q26 4q27 4Q27 4q2f 4Q2F 4r9a 4R9A 4r9b 4R9B 4r9c 4R9C 4r9d 4R9D 4rl7 4RL7 4uw3 4UW3 4uw4 4UW4 4uw5 4UW5 4uw6 4UW6 4wvv 4WVV 4wvw 4WVW 4xbl 4XBL 4xbn 4XBN 4xbq 4XBQ 4xzp 4XZP 4y1u 4Y1U 4y1v 4Y1V 4y1x 4Y1X 4y1y 4Y1Y 4y1z 4Y1Z 4y20 4Y20 4y22 4Y22 4y24 4Y24 4y26 4Y26 4ylz 4YLZ 4ym0 4YM0 4ym1 4YM1 4ym2 4YM2 4ym3 4YM3 5cbl 5CBL 5dg1 5DG1 5dg2 5DG2 5duu 5DUU 5duv 5DUV 5duw 5DUW 5dux 5DUX 5e88 5E88 5e89 5E89 5e8a 5E8A 5ews 5EWS 5exo 5EXO 5gal CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 IN COMPLEX WITH N-ACETYLLACTOSAMINE 5glt 5GLT 5glu 5GLU 5glv 5GLV 5glw 5GLW 5glz 5GLZ 5gm0 5GM0 5h9p 5H9P 5h9q 5H9Q 5h9r 5H9R 5h9s 5H9S 5it6 5IT6 - Links (links to other resources describing this domain)
-
PROSITE GALAPTIN INTERPRO IPR001079 PFAM Gal-bind_lectin