The domain within your query sequence starts at position 285 and ends at position 353; the E-value for the GRAM domain shown below is 2.77e-21.

EFFRAFFRLPREEKLHAVADCSLWTPFSRCHTAGRIFSSDSYICFASREDGCCNVVLPLR
EVVSIEKME

GRAM

domain in glucosyltransferases, myotubularins and other putative membrane-associated proteins
GRAM
SMART accession number:SM00568
Description: -
Interpro abstract (IPR004182):

The GRAM domain is found in glucosyltransferases, myotubularins and other putative membrane-associated proteins. It is normally about 70 amino acids in length. It is thought to be an intracellular protein-binding or lipid-binding signalling domain, which has an important function in membrane-associated processes. The structure of the GRAM domain is similar to that found in PH domains [ (PUBMED:11050430) ]. Mutations in the GRAM domain of myotubularins cause a muscle disease, which suggests that the domain is essential for the full function of the enzyme [ (PUBMED:11050430) ]. Myotubularin-related proteins are a large subfamily of protein tyrosine phosphatases (PTPs) that dephosphorylate D3-phosphorylated inositol lipids [ (PUBMED:14690594) ].

Family alignment:
View or

There are 15261 GRAM domains in 12911 proteins in SMART's nrdb database.

Click on the following links for more information.