The domain within your query sequence starts at position 657 and ends at position 703; the E-value for the Grip domain shown below is 5.68e-18.

REINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKET

Grip

golgin-97, RanBP2alpha,Imh1p and p230/golgin-245
Grip
SMART accession number:SM00755
Description: -
Interpro abstract (IPR000237):

The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [ (PUBMED:10209120) (PUBMED:10209123) (PUBMED:10209125) ] is found in many large coiled-coil proteins. It has been shown to be sufficient for targeting to the Golgi [ (PUBMED:14580338) ]. The GRIP domain contains a completely conserved tyrosine residue.

Family alignment:
View or

There are 2004 Grip domains in 2002 proteins in SMART's nrdb database.

Click on the following links for more information.