The domain within your query sequence starts at position 984 and ends at position 1074; the E-value for the HA2 domain shown below is 1.64e-24.

ASKVRLRDLGALTPDEKLTPLGYHLASLPVDVRIGKLMLLGSIFRCLDPALTIAASLAFK
SPFVSPWDKKEEANQKKLEFAFANSDYLALL

HA2

Helicase associated domain (HA2) Add an annotation
HA2
SMART accession number:SM00847
Description: This presumed domain is about 90 amino acid residues in length. It is found is a diverse set of RNA helicases. Its function is unknown, however it seems likely to be involved in nucleic acid binding.
Interpro abstract (IPR007502):

This presumed domain is about 90 amino acid residues in length. It is found as a diverse set of RNA helicases. Its function is unknown, however it seems likely to be involved in nucleic acid binding.

GO function:helicase activity (GO:0004386)
Family alignment:
View or

There are 38456 HA2 domains in 38427 proteins in SMART's nrdb database.

Click on the following links for more information.