The domain within your query sequence starts at position 384 and ends at position 484; the E-value for the HDAC_interact domain shown below is 2.75e-58.

SCKRIGSSYRALPKTYQQPKCSGRTAICKEVLNDTWVSFPSWSEDSTFVSSKKTPYEEQL
HRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEK

HDAC_interact

Histone deacetylase (HDAC) interacting
HDAC_interact
SMART accession number:SM00761
Description: This domain is found on transcriptional regulators. It forms interactions with histone deacetylases.
Interpro abstract (IPR013194):

This domain is found in the transcriptional repressor Sin3. It forms interactions with histone deacetylases [ (PUBMED:12773392) ].

Budding yeast Sin3 is a component of both the Rpd3S and Rpd3L histone deacetylase complexes [ (PUBMED:16314178) ]. In mammals there are two Sin3 paraologues, Sin3A and Sin3B. They forms the larger Sin3L/Rpd3L and the smaller Sin3S/Rpd3S complexes, both complexes rely largely on HDAC (histone deacetylase) activity to affect transcriptional repression. Sin3A and Sin3B may partition into the Sin3L/Rpd3L and Sin3S/Rpd3S complexes, respectively [ (PUBMED:26124119) ].

Family alignment:
View or

There are 2785 HDAC_interact domains in 2783 proteins in SMART's nrdb database.

Click on the following links for more information.