The domain within your query sequence starts at position 863 and ends at position 971; the E-value for the HELICc domain shown below is 3.22e-16.
KMLYEQLQSNSLFNNRRSHRCVIHPLHSSLSSEEQQAVFVKPPMGVTKIIISTNIAETSI TIDDVVYVIDSGKMKEKRYDAGKGMESLEDTFVSQANALQRKGRAGRVA
HELICchelicase superfamily c-terminal domain |
|---|
| SMART accession number: | SM00490 |
|---|---|
| Description: | - |
| Interpro abstract (IPR001650): | Helicases have been classified in 5 superfamilies (SF1-SF5). For the two largest groups, commonly referred to as SF1 and SF2, a total of seven characteristic motifs has been identified [ (PUBMED:2546125) ]. These two superfamilies encompass a large number of DNA and RNA helicases from archaea, eubacteria, eukaryotes and viruses. This entry represents the C-terminal domain found in proteins belonging to the helicase superfamilies 1 and 2. Included in this group is the eukaryotic translation initiation factor 4A (eIF4A), a member of the DEA(D/H)-box RNA helicase family. The structure of the carboxyl-terminal domain of eIF4A has been determined; it has a parallel alpha-beta topology that superimposes, with minor variations, on the structures and conserved motifs of the equivalent domain in other, distantly related helicases [ (PUBMED:11087862) ]. |
| Family alignment: |
There are 429775 HELICc domains in 427751 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Taxonomic distribution of proteins containing HELICc domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with HELICc domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing HELICc domain in the selected taxonomic class.
- Literature (relevant references for this domain)
-
Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.
- Bork P, Koonin EV
- An expanding family of helicases within the 'DEAD/H' superfamily.
- Nucleic Acids Res. 1993; 21: 751-2
- Disease (disease genes where sequence variants are found in this domain)
-
SwissProt sequences and OMIM curated human diseases associated with missense mutations within the HELICc domain.
Protein Disease Transcriptional regulator ATRX (P46100) (SMART) OMIM:300032: Alpha-thalassemia/mental retardation syndrome
OMIM:301040: Juberg-Marsidi syndrome
OMIM:309590: Sutherland-Haan syndrome
OMIM:309470: Smith-Fineman-Myers syndrome
OMIM:309580: - Metabolism (metabolic pathways involving proteins which contain this domain)
-
Click the image to view the interactive version of the map in iPath% proteins involved KEGG pathway ID Description 42.40 
map00500Starch and sucrose metabolism 42.40 map00790Folate biosynthesis 8.69 map00230Purine metabolism 5.69 map03090 Type II secretion system 0.52 map04310 Wnt signaling pathway 0.10 map00970 Aminoacyl-tRNA biosynthesis 0.10 map03020 RNA polymerase 0.10 map00330Arginine and proline metabolism This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with HELICc domain which could be assigned to a KEGG orthologous group, and not all proteins containing HELICc domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.
- Structure (3D structures containing this domain)
3D Structures of HELICc domains in PDB
PDB code Main view Title 1c4o 
CRYSTAL STRUCTURE OF THE DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB FROM THERMUS THERMOPHILUS 1d2m 
UVRB PROTEIN OF THERMUS THERMOPHILUS HB8; A NUCLEOTIDE EXCISION REPAIR ENZYME 1d9x 
CRYSTAL STRUCTURE OF THE DNA REPAIR PROTEIN UVRB 1d9z 
CRYSTAL STRUCTURE OF THE DNA REPAIR PROTEIN UVRB IN COMPLEX WITH ATP 1fuk 
CRYSTAL STRUCTURE OF THE CARBOXY TERMINAL DOMAIN OF YEAST EIF4A 1fuu 
YEAST INITIATION FACTOR 4A 1gm5 
Structure of RecG bound to three-way DNA junction 1hv8 
CRYSTAL STRUCTURE OF A DEAD BOX PROTEIN FROM THE HYPERTHERMOPHILE METHANOCOCCUS JANNASCHII 1jr6 
Solution Structure of an Engineered Arginine-rich Subdomain 2 of the Hepatitis C Virus NS3 RNA Helicase 1onb 
Solution structure of an engineered arginine-rich subdomain 2 of the hepatitis C virus NS3 RNA helicase 1oyw 
Structure of the RecQ Catalytic Core 1oyy 
Structure of the RecQ Catalytic Core bound to ATP-gamma-S 1s2m 
Crystal Structure of the DEAD box protein Dhh1p 1t5i 
Crystal structure of the C-terminal domain of UAP56 1t5l 
Crystal structure of the DNA repair protein UvrB point mutant Y96A revealing a novel fold for domain 2 1wp9 
Crystal structure of Pyrococcus furiosus Hef helicase domain 1xti 
Structure of Wildtype human UAP56 1xtj 
structure of human UAP56 in complex with ADP 1xtk 
structure of DECD to DEAD mutation of human UAP56 1yks 
Crystal structure of yellow fever virus NS3 helicase 1z3i 
Structure of the SWI2/SNF2 chromatin remodeling domain of eukaryotic Rad54 1z5z 
Sulfolobus solfataricus SWI2/SNF2 ATPase C-terminal domain 1z63 
Sulfolobus solfataricus SWI2/SNF2 ATPase core in complex with dsDNA 1z6a 
Sulfolobus solfataricus SWI2/SNF2 ATPase core domain 2bhr 
Dengue virus RNA helicase 2bmf 
Dengue virus RNA helicase at 2.4A 2d7d 
Structural insights into the cryptic DNA dependent ATP-ase activity of UvrB 2db3 
Structural basis for RNA unwinding by the DEAD-box protein Drosophila Vasa 2eyq 
Crystal structure of Escherichia coli transcription-repair coupling factor 2fdc 
Structural Basis of DNA Damage Recognition and Processing by UvrB: crystal structure of a UvrB/DNA complex 2fwr 
Structure of Archaeoglobus Fulgidis XPB 2fzl 
Structure of C-terminal domain of Archaeoglobus fulgidus XPB 2hjv 
Structure of the second domain (residues 207-368) of the Bacillus subtilis YxiN protein 2hxy 
Crystal structure of human apo-eIF4AIII 2hyi 
Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA 2i4i 
Crystal Structure of human DEAD-box RNA helicase DDX3X 2j0q 
The crystal structure of the Exon Junction Complex at 3.2 A resolution 2j0s 
The crystal structure of the Exon Junction Complex at 2.2 A resolution 2j0u 
The crystal structure of eIF4AIII-Barentsz complex at 3.0 A resolution 2jgn 
DDX3 helicase domain 2kbf 
solution structure of carboxyl-terminal domain of Dbp5p 2nmv 
Damage detection by the UvrABC pathway: Crystal structure of UvrB bound to fluorescein-adducted DNA 2oca 
The crystal structure of T4 UvsW 2p6n 
Human DEAD-box RNA helicase DDX41, helicase domain 2p6r 
Crystal structure of superfamily 2 helicase Hel308 in complex with unwound DNA 2p6u 
Apo structure of the Hel308 superfamily 2 helicase 2qeq 
Crystal structure of kunjin virus ns3 helicase 2rb4 
Crystal structure of the Helicase domain of human DDX25 RNA helicase 2v1x 
Crystal structure of human RECQ-like DNA helicase 2v6i 
Kokobera Virus Helicase 2v6j 
Kokobera Virus Helicase: Mutant Met47Thr 2v8o 
Structure of the Murray Valley encephalitis virus RNA helicase to 1. 9A resolution 2va8 
DNA Repair Helicase Hel308 2vso 
Crystal Structure of a Translation Initiation Complex 2vsx 
Crystal Structure of a Translation Initiation Complex 2wax 
Structure of the human DDX6 C-terminal domain in complex with an EDC3- FDF peptide 2way 
Structure of the human DDX6 C-terminal domain in complex with an EDC3- FDF peptide 2wv9 
Crystal Structure of the NS3 protease-helicase from Murray Valley encephalitis virus 2wwy 
Structure of human RECQ-like helicase in complex with a DNA substrate 2xau 
Crystal structure of the Prp43p DEAH-box RNA helicase in complex with ADP 2xb2 
Crystal structure of the core Mago-Y14-eIF4AIII-Barentsz-UPF3b assembly shows how the EJC is bridged to the NMD machinery 2xgj 
Structure of Mtr4, a DExH helicase involved in nuclear RNA processing and surveillance 2yjt 
Crystal structure of E. coli DEAD-box protein SrmB bound to regulator of ribonuclease activity A (RraA) 2ykg 
Structural insights into RNA recognition by RIG-I 2z0m 
Crystal structure of hypothetical ATP-dependent RNA helicase from Sulfolobus tokodaii 2z83 
Crystal Structure of Catalytic Domain of Japanese Encephalitis Virus NS3 Helicase/Nucleoside Triphosphatase at a Resolution 1.8 2zj2 
Archaeal DNA helicase Hjm apo state in form 1 2zj5 
Archaeal DNA helicase Hjm complexed with ADP in form 1 2zj8 
Archaeal DNA helicase Hjm apo state in form 2 2zja 
Archaeal DNA helicase Hjm complexed with AMPPCP in form 2 2zu6 
crystal structure of the eIF4A-PDCD4 complex 3dmq 
Crystal structure of RapA, a Swi2/Snf2 protein that recycles RNA polymerase during transcription 3eaq 
Novel dimerization motif in the DEAD box RNA helicase Hera form 2, complete dimer, symmetric 3ear 
Novel dimerization motif in the DEAD box RNA helicase Hera: form 1, partial dimer 3eas 
Novel dimerization motif in the DEAD box RNA helicase Hera: form 1, complete dimer, asymmetric 3eiq 
Crystal structure of Pdcd4-eIF4A 3ews 
Human DEAD-box RNA-helicase DDX19 in complex with ADP 3ex7 
The crystal structure of EJC in its transition state 3fho 
Structure of S. pombe Dbp5 3fht 
Crystal structure of human Dbp5 in complex with AMPPNP and RNA 3fmp 
Crystal structure of the nucleoporin Nup214 in complex with the DEAD-box helicase Ddx19 3g0h 
Human dead-box RNA helicase DDX19, in complex with an ATP-analogue and RNA 3gfp 
Structure of the C-terminal domain of the DEAD-box protein Dbp5 3i32 
Dimeric structure of a Hera helicase fragment including the C-terminal RecA domain, the dimerization domain, and the RNA binding domain 3i5x 
Structure of Mss116p bound to ssRNA and AMP-PNP 3i5y 
Structure of Mss116p bound to ssRNA containing a single 5-BrU and AMP-PNP 3i61 
Structure of Mss116p bound to ssRNA and ADP-Beryllium Fluoride 3i62 
Structure of Mss116p bound to ssRNA and ADP-Aluminum Fluoride 3jcm 
3JCM 3jcr 
3JCR 3kx2 
Crystal structure of Prp43p in complex with ADP 3mwy 
Crystal structure of the chromodomain-ATPase portion of the yeast Chd1 chromatin remodeler 3oiy 
Helicase domain of reverse gyrase from Thermotoga maritima 3p4x 
Helicase domain of reverse gyrase from Thermotoga maritima 3p4y 
Helicase domain of reverse gyrase from Thermotoga maritima - P2 form 3peu 
S. cerevisiae Dbp5 L327V C-terminal domain bound to Gle1 H337R and IP6 3pev 
S. cerevisiae Dbp5 L327V C-terminal domain bound to Gle1 and IP6 3pew 
S. cerevisiae Dbp5 L327V bound to RNA and ADP BeF3 3pey 
S. cerevisiae Dbp5 bound to RNA and ADP BeF3 3rc3 
Human Mitochondrial Helicase Suv3 3rc8 
Human Mitochondrial Helicase Suv3 in Complex with Short RNA Fragment 3rrm 
S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp 3rrn 
S. cerevisiae dbp5 l327v bound to gle1 h337r and ip6 3sqw 
Structure of Mss116p (NTE deletion) bound to ssRNA and AMP-PNP 3sqx 
Structure of Mss116p (NTE and C-tail double deletion) bound to ssRNA and AMP-PNP 3tbk 
Mouse RIG-I ATPase Domain 3uwx 
Crystal structure of UvrA-UvrB complex 3v4r 
Crystal structure of a UvrB dimer-DNA complex 3zd6 
Snapshot 1 of RIG-I scanning on RNA duplex 3zd7 
Snapshot 3 of RIG-I scanning on RNA duplex 4a2p 
Structure of duck RIG-I helicase domain 4a2q 
Structure of duck RIG-I tandem CARDs and helicase domain 4a2w 
Structure of full-length duck RIG-I 4a36 
Structure of duck RIG-I helicase domain bound to 19-mer dsRNA and ATP transition state analogue 4a4z 
CRYSTAL STRUCTURE OF THE S. CEREVISIAE DEXH HELICASE SKI2 BOUND TO AMPPNP 4ay2 
Capturing 5' tri-phosphorylated RNA duplex by RIG-I 4bgd 
Crystal structure of Brr2 in complex with the Jab1/MPN domain of Prp8 4bpb 
STRUCTURAL INSIGHTS INTO RNA RECOGNITION BY RIG-I 4bru 
Crystal structure of the yeast Dhh1-Edc3 complex 4brw 
Crystal structure of the yeast Dhh1-Pat1 complex 4buj 
Crystal structure of the S. cerevisiae Ski2-3-8 complex 4c9b 
Crystal structure of eIF4AIII-CWC22 complex 4cbg 
4CBG 4cbh 
4CBH 4cbi 
4CBI 4cbl 
4CBL 4cbm 
4CBM 4cdg 
Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody 4cgz 
Crystal structure of the Bloom's syndrome helicase BLM in complex with DNA 4crw 
Complex of human DDX6 (RECA-C) and CNOT1 (MIF4G) 4ct4 
CNOT1 MIF4G domain - DDX6 complex 4ct5 
DDX6 4d25 
4D25 4d26 
4D26 4db2 
Mss116p DEAD-box helicase domain 2 bound to an RNA duplex 4db4 
Mss116p DEAD-box helicase domain 2 bound to a chimaeric RNA-DNA duplex 4ern 
Crystal structure of the C-terminal domain of human XPB/ERCC-3 excision repair protein at 1.80 A 4f91 
Brr2 Helicase Region 4f92 
Brr2 Helicase Region S1087L 4f93 
Brr2 Helicase Region S1087L, Mg-ATP 4gl2 
Structural Basis for dsRNA duplex backbone recognition by MDA5 4kbf 
two different open conformations of the helicase core of the RNA helicase Hera 4kbg 
almost closed conformation of the helicase core of the RNA helicase Hera 4kit 
Crystal structure of human Brr2 in complex with the Prp8 Jab1/MPN domain 4ljy 
Crystal structure of RNA splicing effector Prp5 in complex with ADP 4lk2 
Crystal structure of RNA splicing effector Prp5 4nho 
4NHO 4nl4 
PriA Helicase Bound to ADP 4nl8 
PriA Helicase Bound to SSB C-terminal Tail Peptide 4o3m 
Ternary complex of Bloom's syndrome helicase 4on9 
4ON9 4pxa 
4PXA 4q47 
4Q47 4q48 
4Q48 4qu4 
4QU4 4s20 
4S20 4tmu 
4TMU 4tyn 
4TYN 4tyw 
4TYW 4tyy 
4TYY 4tz0 
4TZ0 4tz6 
4TZ6 4u4c 
4U4C 4u7d 
4U7D 4w7s 
4W7S 4xgt 
4XGT 4xqk 
4XQK 5a9f 
5A9F 5a9j 
5A9J 5aga 
5AGA 5anr 
5ANR 5aor 
5AOR 5d0u 
5D0U 5dca 
5DCA 5dtu 
5DTU 5dzr 
5DZR 5e02 
5E02 5e3h 
5E3H 5e7i 
5E7I 5e7j 
5E7J 5e7m 
5E7M 5elx 
5ELX 5f98 
5F98 5f9f 
5F9F 5f9h 
5F9H 5ffj 
5FFJ 5ffm 
5FFM 5fmf 
5FMF 5gan 
5GAN 5gao 
5GAO 5gap 
5GAP 5gjb 
5GJB 5gjc 
5GJC 5gm6 
5GM6 5hzr 
5HZR 5ivw 
5IVW 5iy6 
5IY6 5iy7 
5IY7 5iy8 
5IY8 5iy9 
5IY9 5jaj 
5JAJ 5jb2 
5JB2 5jbg 
5JBG 5jbj 
5JBJ 5jc3 
5JC3 5jc7 
5JC7 5jcf 
5JCF 5jch 
5JCH 5jmt 
5JMT 5jrz 
5JRZ 5jwh 
5JWH 5k8i 
5K8I 5k8l 
5K8L 5k8t 
5K8T 5k8u 
5K8U 5lb3 
5LB3 5lb5 
5LB5 5lb8 
5LB8 5lba 
5LBA 5lj5 
5LJ5 5lqw 
5LQW 5sva 
5SVA - Links (links to other resources describing this domain)
-
PFAM helicase_C INTERPRO IPR001650