The domain within your query sequence starts at position 60 and ends at position 154; the E-value for the HIRAN domain shown below is 3.78e-29.

FGTMRGQVVGLRYYTGVVNNNEMVALQREPNNPYDKNAIKVNNVNGNQVGHIKREIAAAV
AYIMDNKLAQVEGVVPFGASNTFTMPLYMTFWGKE

HIRAN

HIRAN
SMART accession number:SM00910
Description: The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes (PUBMED:16627993). It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks (PUBMED:16627993)
Interpro abstract (IPR014905):

The HIRAN domain (HIP116 Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes [ (PUBMED:16627993) ]. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks [ (PUBMED:16627993) ].

GO function:zinc ion binding (GO:0008270), nucleic acid binding (GO:0003676), hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818)
Family alignment:
View or

There are 2542 HIRAN domains in 2541 proteins in SMART's nrdb database.

Click on the following links for more information.