The domain within your query sequence starts at position 235 and ends at position 300; the E-value for the HOX domain shown below is 1.74e-17.

ARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYK
KNIGKF

HOX

Homeodomain
HOX
SMART accession number:SM00389
Description: DNA-binding factors that are involved in the transcriptional regulation of key developmental processes
Interpro abstract (IPR001356):

The homeobox domain or homeodomain was first identified in a number of drosophila homeotic and segmentation proteins, but is now known to be well-conserved in many other animals, including vertebrates [ (PUBMED:2568852) (PUBMED:1357790) ]. Hox genes encode homeodomain-containing transcriptional regulators that operate differential genetic programs along the anterior-posterior axis of animal bodies [ (PUBMED:12445403) ]. The domain binds DNA through a helix-turn-helix (HTH) structure. The HTH motif is characterised by two alpha-helices, which make intimate contacts with the DNA and are joined by a short turn. The second helix binds to DNA via a number of hydrogen bonds and hydrophobic interactions, which occur between specific side chains and the exposed bases and thymine methyl groups within the major groove of the DNA. The first helix helps to stabilise the structure.

The motif is very similar in sequence and structure in a wide range of DNA-binding proteins (e.g., cro and repressor proteins, homeotic proteins, etc.). One of the principal differences between HTH motifs in these different proteins arises from the stereo-chemical requirement for glycine in the turn which is needed to avoid steric interference of the beta-carbon with the main chain: for cro and repressor proteins the glycine appears to be mandatory, while for many of the homeotic and other DNA-binding proteins the requirement is relaxed.

GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 130113 HOX domains in 120724 proteins in SMART's nrdb database.

Click on the following links for more information.