The domain within your query sequence starts at position 138 and ends at position 206; the E-value for the Hr1 domain shown below is 1.13e-21.

SRVAGLEKQLAIELKVKQGAENMIQTYSNGSSKDRKLLLTAQQMLQDSKTKIDIIRMQLR
RALQALQAG

Hr1

Rho effector or protein kinase C-related kinase homology region 1 homologues
Hr1
SMART accession number:SM00742
Description: Alpha-helical domain found in vertebrate PRK1 and yeast PKC1 protein kinases C. The HR1 in rhophilin bind RhoGTP; those in PRK1 bind RhoA and RhoB. Also called RBD - Rho-binding domain
Interpro abstract (IPR011072):

HR1 was first described as a three times repeated homology region of the N-terminal non-catalytic part of protein kinase PRK1(PKN) [ (PUBMED:7851406) ]. The first two of these repeats were later shown to bind the small G protein rho [ (PUBMED:8647255) (PUBMED:9446575) ] known to activate PKN in its GTP-bound form. Similar rho-binding domains also occur in a number of other protein kinases and in the rho-binding proteins rhophilin and rhotekin. Recently, the structure of the N-terminal HR1 repeat complexed with RhoA has been determined by X-ray crystallography. This domain contains two long alpha helices forming a left-handed antiparallel coiled-coil fold termed the antiparallel coiled- coil (ACC) finger domain. The two long helices encompass the basic region and the leucine repeat region, which are identified as the Rho-binding region [ (PUBMED:10619026) (PUBMED:14514689) (PUBMED:27129201) ].

This entry also includes Transducer of Cdc42-dependent actin assembly protein (TOCA) family proteins which contains a central HR1 (also known as Rho effector motif class 1, REM-1) which is closely related to Cdc42-interacting protein 4 (CIP4), effectors of the Rho family small G protein Cdc2 [ (PUBMED:27129201) ].

GO process:signal transduction (GO:0007165)
Family alignment:
View or

There are 6745 Hr1 domains in 3157 proteins in SMART's nrdb database.

Click on the following links for more information.