The domain within your query sequence starts at position 260 and ends at position 465; the E-value for the ICA69 domain shown below is 4.01e-83.

PYEFTTLKSLQDPMKKLVEKEGKKTSWRENREAVAPEPRQLISLEDEHKDSSAYKTEEGT
SVLSSVDKGSVHDTCSACLGPTAGTPEPESGDKDDLLLLNEIFSTSCLDEGEFSREWAAV
FGDDQLKEPAPMGAQGEPDPKPQIGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFS
LFADLDPLSNPDAVGKTDKEHELLNA

ICA69

Islet cell autoantigen ICA69, C-terminal domain
ICA69
SMART accession number:SM01237
Description: This family includes a 69 kD protein which has been identified as an islet cell autoantigen in type I diabetes mellitus (PMID:8975715). Its precise function is unknown.
Interpro abstract (IPR006723):

This entry represents a C-terminal domain found in islet cell autoantigen Ica1. Ica1 has been identified as an islet cell autoantigen in type I diabetes mellitus [ (PUBMED:8975715) ]. Its precise function is unknown, though it may play a role in neurotransmitter secretion [ (PUBMED:11029035) ].

Family alignment:
View or

There are 1020 ICA69 domains in 1020 proteins in SMART's nrdb database.

Click on the following links for more information.