The domain within your query sequence starts at position 58 and ends at position 175; the E-value for the IFabd domain shown below is 1.43e-70.
DFGFPQEKVDAQQIQEAQAIPVLTELTQQMLTLFTSKASSAAWNATLLDSFCNDLHQQLN DLKTCLMQEVGVQESPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVWRAL
IFabdInterferon alpha, beta and delta. |
---|
SMART accession number: | SM00076 |
---|---|
Description: | Interferons produce antiviral and antiproliferative responses in cells. They are classified into five groups, all of them related but gamma-interferon. |
Interpro abstract (IPR000471): | Interferons [ (PUBMED:3022999) ] are proteins which produce antiviral and antiproliferative responses in cells. On the basis of their sequence interferons are classified into five groups: alpha, alpha-II (or omega), beta, delta (or trophoblast) and gamma. Proteins in this entry are different from the interferon gamma family. The sequence differences may possibly cause different responses to various inducers, or result in the recognition of different target cell types [ (PUBMED:6170983) ]. All function as regulators of cellular activty by interacting with cell-surface receptors and activating various signalling pathways. Interferons produce antiviral and antiproliferative responses in cells. Receptor specificity determines function of the various members of the family [ (PUBMED:10547147) ]. The main conserved structural feature of interferons is a disulphide bond that, except in mouse beta interferon, occurs in all alpha, beta and omega sequences. Type I interferons (alpha, beta) belong to the larger helical cytokine superfamily, which includes growth hormones, interleukins, several colony-stimulating factors and several other regulatory molecules. This entry also includes also interferon omega and tau. |
GO process: | defense response (GO:0006952) |
GO component: | extracellular region (GO:0005576) |
GO function: | cytokine receptor binding (GO:0005126) |
Family alignment: |
There are 2209 IFabd domains in 2202 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)