The domain within your query sequence starts at position 280 and ends at position 381; the E-value for the IG domain shown below is 8.01e-3.

PVTCHAAEGGSVLLQVHNLPEDVQTFSWYKGVDSTPYFRIVEYSKAMKSIFSGYAHSRRE
TGYTNGSLLLQDVTEKDTGFYTLLTIDSHVKVETVHAQVNVH

IG

Immunoglobulin
IG
SMART accession number:SM00409
Description: -
Interpro abstract (IPR003599):

The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 ), C1-set (constant-1; IPR003597 ), C2-set (constant-2; IPR008424 ) and I-set (intermediate; IPR013098 ) [ (PUBMED:9417933) ]. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [ (PUBMED:15327963) (PUBMED:11377196) ].

Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [ (PUBMED:10698639) ].

This subfamily includes:

  • Cell surface receptors containing an immunoglobin domain.
  • Killer cell inhibitory receptors.
  • Oprin a snake venom metalloproteinase inhibitor from Didelphis marsupialis (Southern opossum) [ (PUBMED:10779682) ], which belongs to MEROPS inhibitor family I43, clan I- [ (PUBMED:14705960) ].
  • Oprin homologues.
Family alignment:
View or

There are 417572 IG domains in 173507 proteins in SMART's nrdb database.

Click on the following links for more information.