The domain within your query sequence starts at position 705 and ends at position 742; the E-value for the IKKbetaNEMObind domain shown below is 4.71e-16.

SEELVAEAHALCSRLESALQDTVKEQDRSFTTLDWSWL

IKKbetaNEMObind

I-kappa-kinase-beta NEMO binding domain
IKKbetaNEMObind
SMART accession number:SM01239
Description: This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with S_TKc. These proteins are involved in inflammatory reactions. They cause release of NF-kappa-B into the nucleus of inflammatory cells and upregulation of transcription of proinflammatory cytokines. They perform this function by phosphorylating I-kappa-B proteins which are targeted for degradation to release NF-kappa-B. This kinase (I-kappa-kinase-beta) is found in association with IKK-alpha and NEMO (NF-kappa-B essential modulator). This domain is the binding site of IKK-beta for NEMO.
Interpro abstract (IPR022007):

This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with . These proteins are involved in inflammatory reactions. They cause release of NF-kappa-B into the nucleus of inflammatory cells and upregulation of transcription of proinflammatory cytokines. They perform this function by phosphorylating I-kappa-B proteins which are targeted for degradation to release NF-kappa-B. This kinase (I-kappa-kinase-beta) is found in association with IKK-alpha and NEMO (NF-kappa-B essential modulator). This domain is the binding site of IKK-beta for NEMO.

GO function:IkappaB kinase activity (GO:0008384)
Family alignment:
View or

There are 606 IKKbetaNEMObind domains in 603 proteins in SMART's nrdb database.

Click on the following links for more information.