The domain within your query sequence starts at position 49 and ends at position 179; the E-value for the IL10 domain shown below is 5.21e-1.

QPYIVNRTFMLAKEVSLADNNTDVWLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQS
DRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELD
LLFMSLRNACV

IL10

Interleukin-10 family
IL10
SMART accession number:SM00188
Description: Interleukin-10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells.
Interpro abstract (IPR020443):

Interleukin-10 (IL-10) is a protein that inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells. Structurally, IL-10 is a protein of about 160 amino acids that contains four conserved cysteines involved in disulphide bonds [ (PUBMED:8590020) ]. IL-10 is highly similar to the Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) BCRF1 protein which inhibits the synthesis of gamma-interferon and to Equid herpesvirus 2 (Equine herpesvirus 2) protein E7. It is also similar, but to a lesser degree, with human protein mda-7 [ (PUBMED:8545104) ], a protein which has antiproliferative properties in human melanoma cells. Mda-7 only contains two of the four cysteines of IL-10.

This entry represents the interleukin-10, interleukin-19, interleukin-20, interleukin-22, interleukin-24 and interleukin-26 family.

Family alignment:
View or

There are 1073 IL10 domains in 1072 proteins in SMART's nrdb database.

Click on the following links for more information.