The domain within your query sequence starts at position 2418 and ends at position 2527; the E-value for the K167R domain shown below is 1.71e-42.
LAKLPSSSPPLEPTDTSVTSRRQARTGLRKVHVKNELSGGIMHPQISGEIVDLPREPEGE GKVIKTRKQSVKRKLDTEVNVPRSKRQRITRAEKTLEDLPGFQELCQAPS
K167RK167/Chmadrin repeat |
---|
SMART accession number: | SM01295 |
---|---|
Description: | This family represents the K167/Chmadrin repeat. (PMID:15112237) The function of this repeat is unknown. |
Interpro abstract (IPR012568): | This entry represents the KI67/Chmadrin repeat [ (PUBMED:15112237) ]. It can be found in the human antigen KI-67 protein [ (PUBMED:8227122) ]. The function of this repeat is unknown. |
Family alignment: |
There are 2375 K167R domains in 356 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)