The domain within your query sequence starts at position 302 and ends at position 441; the E-value for the Ku78 domain shown below is 8.9e-52.
ETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHRRFFMGHQV LKVFAAKDDEAAAVALSSLVHALDELNMVAIVRYAYDKRSNPQVGVAFPYIKDAYECLVY VQLPFMEDLRQYMFSSLKNN
Ku78Ku70 and Ku80 are 70kDa and 80kDa subunits of the Lupus Ku autoantigen |
---|
SMART accession number: | SM00559 |
---|---|
Description: | This is a single stranded DNA- and ATP-depedent helicase that has a role in chromosome translocation. This is a domain of unknown function C-terminal to its von Willebrand factor A domain, that also occurs in bacterial hypothetical proteins. |
Interpro abstract (IPR006164): | The Ku heterodimer (composed of Ku70 and Ku80) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway. This is the central DNA-binding beta-barrel domain. This domain is found in both the Ku70 and Ku80 proteins that form a DNA binding heterodimer [ (PUBMED:11493912) ]. |
GO process: | double-strand break repair via nonhomologous end joining (GO:0006303) |
GO function: | DNA binding (GO:0003677) |
Family alignment: |
There are 6431 Ku78 domains in 6429 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)