The domain within your query sequence starts at position 157 and ends at position 254; the E-value for the LINK domain shown below is 2.22e-56.

TGVVFHYRAARDRYALTFAEAQEACRLSSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVR
YPITQSRPGCYGDRSSLPGVRSYGRRDPQELYDVYCFA

LINK

Link (Hyaluronan-binding)

• SMART accession number: SM00445
• Description: -
• Interpro abstract (IPR000538):

  The link domain [ (PUBMED:8318021) ] is a hyaluronan(HA)-binding region found in proteins of vertebrates that are involved in the assembly of extracellular matrix, cell adhesion, and migration. The structure has been shown [ (PUBMED:8797823) ] to consist of two alpha helices and two antiparallel beta sheets arranged around a large hydrophobic core similar to that of C-type lectin. This domain contains four conserved cysteines involved in two disulphide bonds. The link domain has also been termed HABM [ (PUBMED:8318021) ] (HA binding module) and PTR [ (PUBMED:8690089) ] (proteoglycan tandem repeat). Proteins with such a domain include the proteoglycans aggrecan, brevican, neurocan and versican, which are expressed in the CNS; the cartilage link protein (LP), a proteoglycan that together with HA and aggrecan forms multimolecular aggregates; Tumour necrosis factor-inducible protein TSG-6, which may be involved in cell-cell and cell-matrix interactions during inflammation and tumourgenesis; and CD44 antigen, the main cell surface receptor for HA.

• GO process: cell adhesion (GO:0007155)
• GO function: hyaluronic acid binding (GO:0005540)

There are 10282 LINK domains in 6262 proteins in SMART's nrdb database.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
50.00	map04640	Hematopoietic cell lineage
50.00	map04512	ECM-receptor interaction

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with LINK domain which could be assigned to a KEGG orthologous group, and not all proteins containing LINK domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of LINK domains in PDB

PDB code	Title
1o7b	Refined solution structure of the human TSG-6 Link module
1o7c	Solution structure of the human TSG-6 Link module in the presence of a hyaluronan octasaccharide (i.e. bound conformation)
1poz	SOLUTION STRUCTURE OF THE HYALURONAN BINDING DOMAIN OF HUMAN CD44
1uuh	Hyaluronan binding domain of human CD44
2i83	hyaluronan-binding domain of CD44 in its ligand-bound form
2jcp	The hyaluronan binding domain of murine CD44
2jcq	The hyaluronan binding domain of murine CD44 in a Type A complex with an HA 8-mer
2jcr	The hyaluronan binding domain of murine CD44 in a Type B complex with an HA 8-mer
2n40	2N40
2pf5	Crystal Structure of the Human TSG-6 Link Module
4mrd	Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
4mre	Crystal structure of the murine CD44 hyaluronan binding domain complex with a small molecule
4mrf	Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
4mrg	Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
4mrh	Crystal structure of the murine CD44 hyaluronan binding domain complex with a small molecule
4np2	Crystal structure of the murine CD44 hyaluronan binding domain complex with a small molecule
4np3	Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
4pz3	4PZ3
4pz4	4PZ4
5bzc	5BZC
5bze	5BZE
5bzf	5BZF
5bzg	5BZG
5bzh	5BZH
5bzi	5BZI
5bzj	5BZJ
5bzk	5BZK
5bzl	5BZL
5bzm	5BZM
5bzn	5BZN
5bzo	5BZO
5bzp	5BZP
5bzq	5BZQ
5bzr	5BZR
5bzs	5BZS
5bzt	5BZT

Links (links to other resources describing this domain)

• PROSITE: LINK
• PFAM: Xlink
• INTERPRO: IPR000538