The domain within your query sequence starts at position 111 and ends at position 357; the E-value for the LON domain shown below is 3.95e-62.

HLPLIAITRNPVFPRFIKIVEVKNKKLVELLRRKVRLAQPYVGVFLKRDDNNESDVVESL
DEIYHTGTFAQIHEMQDLGDKLRMIVTGHRRIHISRQLEVEPEGLEPEAEKQKSRRKLKR
GKKEVEDELGPKPQLEMVTEAATDTSKEVLMVEVENVAHEDFQVTEEVKALTAEIVKTIR
DIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNILKRLYK
ALSLLKK

LON

Found in ATP-dependent protease La (LON)
LON
SMART accession number:SM00464
Description: N-terminal domain of the ATP-dependent protease La (LON), present also in other bacterial ORFs.
Interpro abstract (IPR003111):

This signature defines the N-terminal substrate-binding domain of the archael, bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). In the eukaryotes the majority of the proteins are located in the mitochondrial matrix [ (PUBMED:8248235) (PUBMED:9620272) ]. In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response [ (PUBMED:8276800) ].

This structure of this domain has been determined [ (PUBMED:16199667) (PUBMED:19191354) (PUBMED:20834233) ]. This domain also occurs in proteins which lack the peptidase domain, such as the SPBC14F5.10c gene product from Schizosaccharomyces pombe; these proteins are uncharacterized.

Family alignment:
View or

There are 17617 LON domains in 17613 proteins in SMART's nrdb database.

Click on the following links for more information.