The domain within your query sequence starts at position 494 and ends at position 698; the E-value for the Lactamase_B domain shown below is 1.75e0.

NVSSTLVNLSPDKSVLLDCGEGTFGQLCRHYGQQIDRVLCSLTAVFVSHLHADHHTGLLN
ILLQREHALASLGKPFQPLLVVAPTQLRAWLQQYHNHCQEILHHVSMIPAKCLQKGAEVS
NTTLERLISLLLETCDLEEFQTCLVRHCKHAFGCALVHSSGWKVVYSGDTMPCEALVQMG
KDATLLIHEATLEDGLEEEAVEKTH

Lactamase_B

Metallo-beta-lactamase superfamily
Lactamase_B
SMART accession number:SM00849
Description: Apart from the beta-lactamases a number of other proteins contain this domain (PUBMED:7588620). These proteins include thiolesterases, members of the glyoxalase II family, that catalyse the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid and a competence protein that is essential for natural transformation in Neisseria gonorrhoeae and could be a transporter involved in DNA uptake. Except for the competence protein these proteins bind two zinc ions per molecule as cofactor.
Interpro abstract (IPR001279):

Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [ (PUBMED:7588620) ]. These proteins include thiolesterases, members of the glyoxalase II family, that catalyse the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid and a competence protein that is essential for natural transformation in Neisseria gonorrhoeae and could be a transporter involved in DNA uptake. Except for the competence protein these proteins bind two zinc ions per molecule as cofactor.

Family alignment:
View or

There are 264030 Lactamase_B domains in 263820 proteins in SMART's nrdb database.

Click on the following links for more information.