The domain within your query sequence starts at position 114 and ends at position 263; the E-value for the LamGL domain shown below is 1.55e-54.

DAFTLQVWLRAEGGQKSPAVITGLYDKCSYTSRDRGWVMGIHTTSDQGNRDPRYFFSLKT
DRARKVTTIDAHRSYLPGQWVHLAATYDGRLMKLYMNGAQVATSAEQVGGIFSPLTQKCK
VLMLGGSALNHNFRGHIEHFSLWKVARTQR

LamGL

LamG-like jellyroll fold domain

• SMART accession number: SM00560
• Description: -
• Interpro abstract (IPR006558):

  This LamG-like jellyroll fold domain is found in the metalloproteinase Pappalysin-1 [ (PUBMED:17314100) ] and Usherin [ (PUBMED:17360538) ]. Its function is unknown.

There are 2130 LamGL domains in 997 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Beckmann G, Hanke J, Bork P, Reich JG
• Merging extracellular domains: fold prediction for laminin G-like and amino-terminal thrombospondin-like modules based on homology to pentraxins.
• J Mol Biol. 1998; 275: 725-30

Using a new method for construction and database searches of sequence consensus strings, we have identified a new superfamily of protein modules comprising laminin G, thrombospondin N and the pentraxin families. The conserved patterns correspond mainly to hydrophobic core residues located in central beta strands of the known three-dimensional structures of two pentraxins, the human C-reactive protein and the serum amyloid P-component. Thus, we predict a similar jellyroll fold for all members of this superfamily. In addition, the conservation of two exposed aspartate residues in the majority of superfamily members suggests hitherto unrecognised functional sites.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
20.00	map00511	N-Glycan degradation
20.00	map00600	Sphingolipid metabolism
20.00	map01032	Glycan structures - degradation
10.00	map00604	Glycosphingolipid biosynthesis - ganglioseries
10.00	map00531	Glycosaminoglycan degradation
10.00	map00561	Glycerolipid metabolism
10.00	map00052	Galactose metabolism

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with LamGL domain which could be assigned to a KEGG orthologous group, and not all proteins containing LamGL domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of LamGL domains in PDB

PDB code	Title
4qvs	4QVS

Links (links to other resources describing this domain)

• INTERPRO: IPR006558